Protein Family IF00889

Metagenome Metatranscriptome Isolate
231 Members
89 Samples
188 Scaffolds
357.97 Avg Length

🧬 Representative Sequence

ID
3300002504|JGI24705J35276_12232821|JGI24705J35276_122328215
Length
424 aa
Sequence
MVGYLVLENGDVFKGERIGSNNDVAFELVFNTEMFGYMEVFTDPSYFGQGLLMTYPLIGNYGVIPEDFESEKIWAEAIFVNEFVENGNNFRAKCGLDKFLKNSNIPGLKGVNTEEIAKVLKECGTLKGYLTSEINNIEEILEKIKKYKIEKPIDKVTCRTKLVFGKTKPKQIALIDYGVKHNIVNSLLKRNVGVTVYPAGTSAETILTVRPSGIVLSNGPGNPKEYDTQIEVIKKLCKTNIPILGIGLGHQLLAIAMGAKTEKLKYGHRGNYPIKNLKKDKVNITSQNHGYCVSKNSIDLEIAEIVHINLEDETIEGLKYKNKNIVSVQFQPEACPGPEDANYIFDEFVNGFYKNIDEDGNIKLLKTVPNIEDKQSLKDIMQAINVPYMSKDEKHIADWKEIGYELIRDNKRKLYNSLQHGKY*

📊 Sample Types

Isolate 18.6%
Metagenome 81.0%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 44.0%
Termitidae 32.1%
Kalotermitidae 7.1%
Formicidae 3.6%
Rhinotermitidae 2.4%
Elmidae 2.4%
Passalidae 2.4%
Hodotermitidae 1.2%
Daphniidae 1.2%
Cambaridae 1.2%
Termopsidae 1.2%
Drosophilidae 1.2%

🌳 Taxonomy

Archaea 3
Bacteria 223
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2882250448 Bizionia sp. APA-3 Isolate
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
4 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 2904728850 Flavobacterium sp. xlx-214 Isolate
17 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
18 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
19 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
20 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
21 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
22 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
32 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
33 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
34 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
35 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
36 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
39 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
40 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
41 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
48 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
49 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
52 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
53 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
54 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
55 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
56 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
57 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
58 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
61 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
62 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
63 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
64 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
65 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
66 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
70 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
71 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
72 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
73 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
74 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
75 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
76 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
77 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
78 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
79 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
80 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
83 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
84 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
85 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
86 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
87 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
88 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
89 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466696_079855 3300042596 Bacteria 15369
2 Ga0466706_041625 3300042599 Bacteria 25684
3 Ga0466719_043513 3300042606 Bacteria 2743
4 Ga0466720_066729 3300042607 Bacteria 10048
5 Ga0466720_110133 3300042607 Bacteria 7084
6 Ga0466720_218873 3300042607 Unclassified 1303
7 Ga0466732_127171 3300042656 Bacteria 9699
8 AustNasuHG_c1001306 3300000089 Bacteria 8942
9 AustNasuHG_c1002286 3300000089 Bacteria 6921
10 JGI24698J34947_10002764 3300002449 Bacteria 9495
11 JGI24698J34947_10012821 3300002449 Archaea 4586
12 JGI24698J34947_10018571 3300002449 Bacteria 3756
13 Ga0072941_1475654 3300005201 Bacteria 2095
14 Ga0104045_1003632 3300007085 Bacteria 6755
15 Ga0123357_10000157 3300009784 Bacteria 60865
16 Ga0466705_506414 3300042612 Bacteria 5165
17 Ga0466712_032721 3300042614 Bacteria 21348
18 Ga0466712_155308 3300042614 Bacteria 2734
19 Ga0466715_213689 3300042616 Bacteria 48053
20 Ga0466715_536042 3300042616 Bacteria 12233
21 Ga0466718_162315 3300042617 Bacteria 1735
22 Ga0466702_298503 3300042635 Bacteria 3095
23 Ga0466704_613158 3300042643 Unclassified 1113
24 Ga0264413_104306 3300024493 Bacteria 15415
25 Ga0466706_163386 3300042599 Bacteria 5158
26 Ga0466720_202859 3300042607 Unclassified 1823
27 Ga0123355_10003266 3300009826 Bacteria 23169
28 Ga0123355_10167797 3300009826 Bacteria 3289
29 Ga0123353_10112447 3300010167 Bacteria 4385
30 Ga0466705_158168 3300042612 Bacteria 10450
31 Ga0466732_208334 3300042656 Bacteria 3846
32 IMNBL1DRAFT_c0000373 3300000062 Unclassified 38278
33 JGI24698J34947_10007770 3300002449 Bacteria 5890
34 JGI24698J34947_10010383 3300002449 Bacteria 5107
35 JGI24698J34947_10012741 3300002449 Bacteria 4602
36 JGI24698J34947_10026764 3300002449 Bacteria 3062
37 Ga0072940_1032719 3300005200 Bacteria 3672
38 Ga0072941_1005628 3300005201 Bacteria 4615
39 Ga0466712_012817 3300042614 Bacteria 12480
40 Ga0466712_054915 3300042614 Bacteria 81067
41 Ga0466712_086077 3300042614 Bacteria 2324
42 Ga0466715_626207 3300042616 Bacteria 54952
43 Ga0466718_109287 3300042617 Bacteria 23473
44 Ga0466718_118279 3300042617 Bacteria 3267
45 Ga0466718_130583 3300042617 Bacteria 2943
46 Ga0466702_184273 3300042635 Bacteria 2889
47 Ga0466702_239165 3300042635 Bacteria 2208
48 Ga0264413_130950 3300024493 Unclassified 1594
49 Ga0415639_057604 3300038395 Bacteria 1630
50 Ga0466714_121495 3300042603 Bacteria 28903
51 Ga0466720_115322 3300042607 Bacteria 42347
52 Ga0466722_014813 3300042609 Bacteria 8778
53 Ga0466698_365833 3300042610 Bacteria 2264
54 Ga0466698_381628 3300042610 Bacteria 10303
55 Ga0123355_10001344 3300009826 Bacteria 34139
56 Ga0123353_10002784 3300010167 Bacteria 21829
57 2227494066 2225789004 Bacteria 20333
58 AustNasuHG_c1015706 3300000089 Bacteria 2549
59 JGI24698J34947_10003566 3300002449 Bacteria 8450
60 CVPL010W_10006998 3300002931 Bacteria 11295
61 Ga0104045_1075333 3300007085 Bacteria 2036
62 Ga0466712_021182 3300042614 Bacteria 18924
63 Ga0466712_250860 3300042614 Bacteria 5394
64 Ga0466729_261638 3300042621 Bacteria 163955
65 Ga0466702_106398 3300042635 Bacteria 2252
66 Ga0466704_608829 3300042643 Bacteria 104400
67 Ga0264413_108908 3300024493 Bacteria 9597
68 Ga0466693_127953 3300042592 Bacteria 1983
69 Ga0466699_438660 3300042597 Bacteria 3199
70 Ga0466719_462795 3300042606 Bacteria 6384
71 Ga0466720_218416 3300042607 Bacteria 1318
72 Ga0466722_147052 3300042609 Bacteria 82065
73 Ga0123355_10004150 3300009826 Bacteria 21021
74 Ga0123355_10012453 3300009826 Bacteria 13172
75 Ga0123355_10075814 3300009826 Bacteria 5381
76 Ga0123355_10270630 3300009826 Bacteria 2361
77 Ga0123356_10488058 3300010049 Bacteria 1386
78 Ga0123353_10049349 3300010167 Bacteria 6705
79 Ga0466732_148094 3300042656 Bacteria 1988
80 Ga0466732_370565 3300042656 Bacteria 1464
81 Ga0466733_134180 3300042659 Bacteria 1406
82 2227119714 2225789004 Bacteria 9170
83 IMNBL1DRAFT_c0000032 3300000062 Bacteria 125696
84 IMNBL1DRAFT_c0000334 3300000062 Bacteria 40007
85 AustNasuHG_c1009740 3300000089 Bacteria 3366
86 JGI24698J34947_10001444 3300002449 Bacteria 12509
87 JGI24698J34947_10016631 3300002449 Bacteria 3990
88 JGI24698J34947_10018469 3300002449 Bacteria 3766
89 JGI24698J34947_10037175 3300002449 Bacteria 2531
90 JGI24695J34938_10006443 3300002450 Bacteria 7045
91 JGI24703J35330_11748536 3300002501 Bacteria 18955
92 Ga0072941_1040491 3300005201 Bacteria 4947
93 Ga0466718_004635 3300042617 Bacteria 2032
94 Ga0466718_103383 3300042617 Bacteria 7751
95 Ga0466718_167103 3300042617 Bacteria 12579
96 Ga0466702_336294 3300042635 Bacteria 3942
97 Ga0466693_248755 3300042592 Bacteria 5479
98 Ga0466694_174349 3300042594 Bacteria 93398
99 Ga0466699_071356 3300042597 Bacteria 5028
100 Ga0466706_223825 3300042599 Bacteria 13439
101 Ga0466720_027910 3300042607 Bacteria 7389
102 Ga0466720_056099 3300042607 Bacteria 4477
103 Ga0466720_127186 3300042607 Bacteria 4515
104 Ga0466698_029699 3300042610 Bacteria 18817
105 Ga0466698_063566 3300042610 Bacteria 5197
106 Ga0466698_243001 3300042610 Bacteria 1715
107 Ga0123355_10000853 3300009826 Bacteria 42039
108 Ga0123355_10087766 3300009826 Bacteria 4942
109 Ga0123355_10284939 3300009826 Bacteria 2275
110 IMNBL1DRAFT_c0026273 3300000062 Bacteria 2214
111 JGI24698J34947_10002262 3300002449 Bacteria 10317
112 JGI24695J34938_10000486 3300002450 Bacteria 38538
113 JGI24700J35501_10930570 3300002508 Bacteria 15892
114 Ga0072940_1000897 3300005200 Bacteria 20293
115 Ga0074263_109624 3300005485 Bacteria 5458
116 Ga0466712_314745 3300042614 Bacteria 34934
117 Ga0466718_043711 3300042617 Bacteria 5622
118 Ga0466718_052770 3300042617 Bacteria 5596
119 Ga0466718_160334 3300042617 Bacteria 1378
120 Ga0466702_249320 3300042635 Bacteria 14080
121 Ga0264413_101684 3300024493 Bacteria 18599
122 Ga0415639_092149 3300038395 Bacteria 1577
123 Ga0415639_151752 3300038395 Bacteria 4808
124 Ga0466693_364957 3300042592 Bacteria 2653
125 Ga0466699_087352 3300042597 Bacteria 2748
126 Ga0466706_104187 3300042599 Bacteria 6292
127 Ga0466706_253390 3300042599 Bacteria 4333
128 Ga0466714_076058 3300042603 Bacteria 2122
129 Ga0466720_121956 3300042607 Bacteria 8223
130 Ga0466722_204410 3300042609 Bacteria 3451
131 Ga0466698_083405 3300042610 Bacteria 2680
132 Ga0466732_127367 3300042656 Bacteria 10479
133 IMNBL1DRAFT_c0001484 3300000062 Bacteria 17492
134 AustNasuHG_c1001496 3300000089 Bacteria 8376
135 JGI24698J34947_10001576 3300002449 Bacteria 12081
136 JGI24698J34947_10007479 3300002449 Bacteria 6003
137 JGI24698J34947_10048912 3300002449 Bacteria 2139
138 JGI24695J34938_10002198 3300002450 Bacteria 15203
139 JGI24695J34938_10008106 3300002450 Bacteria 6044
140 JGI24705J35276_12232821 3300002504 Bacteria 4531
141 Ga0072941_1018149 3300005201 Bacteria 8007
142 Ga0074263_110359 3300005485 Bacteria 4470
143 Ga0102740_1001050 3300007140 Bacteria 7283
144 Ga0466712_055244 3300042614 Bacteria 3078
145 Ga0466712_219405 3300042614 Bacteria 1291
146 Ga0466718_011941 3300042617 Archaea 2920
147 Ga0466729_147210 3300042621 Bacteria 6405
148 Ga0223674_1023338 3300021235 Bacteria 1453
149 Ga0466706_131160 3300042599 Bacteria 9350
150 Ga0466707_200198 3300042601 Bacteria 7294
151 Ga0466716_183734 3300042605 Bacteria 316127
152 Ga0466720_085977 3300042607 Bacteria 8276
153 Ga0466720_113530 3300042607 Bacteria 6898
154 Ga0123355_10001092 3300009826 Bacteria 37485
155 Ga0123355_10002423 3300009826 Bacteria 26361
156 Ga0466732_255003 3300042656 Archaea 12212
157 Ga0466732_379577 3300042656 Bacteria 21224
158 2227471850 2225789004 Bacteria 23461
159 IMNBL1DRAFT_c0002348 3300000062 Bacteria 13240
160 IMNBL1DRAFT_c0002469 3300000062 Bacteria 12861
161 JGI24698J34947_10047480 3300002449 Bacteria 2179
162 JGI24698J34947_10061795 3300002449 Bacteria 1841
163 JGI24695J34938_10002241 3300002450 Bacteria 14990
164 Ga0466718_011030 3300042617 Bacteria 12848
165 Ga0466718_115277 3300042617 Bacteria 30003
166 Ga0466702_075402 3300042635 Bacteria 1210
167 Ga0466702_449019 3300042635 Bacteria 1513
168 Ga0466704_471434 3300042643 Bacteria 11240
169 Ga0264413_101913 3300024493 Bacteria 41909
170 Ga0466657_098945 3300042582 Bacteria 51985
171 Ga0466720_064250 3300042607 Bacteria 3302
172 Ga0466721_251890 3300042608 Bacteria 3052
173 Ga0466722_167478 3300042609 Bacteria 5842
174 Ga0123355_10003039 3300009826 Bacteria 23900
175 Ga0123355_10013571 3300009826 Bacteria 12690
176 Ga0123355_10081314 3300009826 Bacteria 5170
177 Ga0123354_10069272 3300010882 Bacteria 5117
178 IMNBL1DRAFT_c0002172 3300000062 Bacteria 13871
179 IMNBL1DRAFT_c0006731 3300000062 Bacteria 6217
180 JGI24698J34947_10001674 3300002449 Bacteria 11831
181 JGI24695J34938_10000233 3300002450 Bacteria 52947
182 JGI24695J34938_10017801 3300002450 Bacteria 3569
183 Ga0102734_1002625 3300007129 Bacteria 5394
184 Ga0466712_002731 3300042614 Bacteria 17880
185 Ga0466718_001573 3300042617 Bacteria 3698
186 Ga0466718_012651 3300042617 Bacteria 5596
187 Ga0466704_354940 3300042643 Bacteria 13993
188 Ga0466727_326385 3300042655 Bacteria 4249

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 5 129 0.99
PF00117 GATase Glutamine amidotransferase class-I 174 349 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.