Protein Family IF00871

Metagenome Metatranscriptome Isolate
150 Members
55 Samples
130 Scaffolds
98.47 Avg Length

🧬 Representative Sequence

ID
3300002501|JGI24703J35330_11748856|JGI24703J35330_1174885620
Length
109 aa
Sequence
MADVQTNLNQKLPQDIIISPVITEKANDNLLIGKYTFKVAKDSNKIEIKKAVESLFDGVKVQKVNTMNVRGQFRRQGRNRGGYTASWKKAIVTLAEGSKTIEFFEGMV*

📊 Sample Types

Isolate 13.3%
Metagenome 86.0%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 34.5%
Kalotermitidae 9.1%
Termopsidae 5.5%
Passalidae 3.6%
Apidae 1.8%
Scarabaeidae 1.8%
Stratiomyidae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
2 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
3 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
4 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
5 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
6 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
7 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
8 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
14 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
28 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
29 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
30 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
42 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
49 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
50 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
51 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
52 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
55 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_11012038 3300009784 Bacteria 515
2 Ga0123355_10429201 3300009826 Bacteria 1682
3 Ga0123355_10534418 3300009826 Bacteria 1427
4 Ga0123356_10649506 3300010049 Bacteria 1222
5 Ga0123356_10870145 3300010049 Bacteria 1072
6 Ga0123353_11843549 3300010167 Bacteria 749
7 IMNBL1DRAFT_c0111689 3300000062 Bacteria 725
8 Ga0068305_10734340 3300005083 Bacteria 541
9 Ga0466706_152973 3300042599 Bacteria 4033
10 Ga0466700_370044 3300042600 Bacteria 1067
11 Ga0466707_401523 3300042601 Bacteria 35627
12 Ga0466698_011576 3300042610 Bacteria 51802
13 Ga0466704_247371 3300042643 Bacteria 16334
14 Ga0466704_376556 3300042643 Bacteria 2660
15 Ga0123357_10484051 3300009784 Bacteria 1043
16 Ga0123355_10016864 3300009826 Bacteria 11523
17 Ga0123355_10021084 3300009826 Bacteria 10425
18 Ga0123355_10029095 3300009826 Bacteria 8938
19 Ga0123355_10046003 3300009826 Bacteria 7098
20 Ga0123355_10397933 3300009826 Bacteria 1779
21 Ga0123355_11216800 3300009826 Bacteria 767
22 Ga0123356_10000163 3300010049 Bacteria 75104
23 Ga0123356_10005526 3300010049 Bacteria 12858
24 Ga0123353_11348096 3300010167 Bacteria 922
25 Ga0415639_129149 3300038395 Bacteria 1122
26 Ga0466656_083433 3300042550 Bacteria 1218
27 Ga0466693_132580 3300042592 Unclassified 1938
28 JGI24702J35022_10777837 3300002462 Bacteria 596
29 JGI24700J35501_10729305 3300002508 Bacteria 1246
30 Ga0068305_10790317 3300005083 Bacteria 649
31 Ga0466707_113611 3300042601 Bacteria 15317
32 Ga0466707_304242 3300042601 Bacteria 14355
33 Ga0466707_403336 3300042601 Bacteria 1164
34 Ga0466714_036045 3300042603 Bacteria 6161
35 Ga0466697_138862 3300042611 Bacteria 1097
36 Ga0466727_246292 3300042655 Bacteria 1555
37 Ga0123355_10000171 3300009826 Bacteria 79083
38 Ga0123355_10380925 3300009826 Bacteria 1838
39 Ga0123355_10419949 3300009826 Bacteria 1710
40 Ga0123355_10796018 3300009826 Bacteria 1055
41 Ga0123355_11723011 3300009826 Bacteria 596
42 Ga0123356_10062997 3300010049 Bacteria 3464
43 Ga0123356_10257820 3300010049 Bacteria 1826
44 Ga0123356_11057774 3300010049 Bacteria 981
45 Ga0123356_11225180 3300010049 Bacteria 916
46 Ga0123356_12187589 3300010049 Bacteria 691
47 Ga0123356_13506431 3300010049 Bacteria 544
48 Ga0123353_10176529 3300010167 Bacteria 3386
49 Ga0123353_11464054 3300010167 Bacteria 873
50 Ga0123353_12234449 3300010167 Bacteria 660
51 Ga0223683_1008551 3300021245 Bacteria 649
52 Ga0466694_190604 3300042594 Bacteria 1316
53 2227497349 2225789004 Bacteria 758
54 IMNBL1DRAFT_c0133742 3300000062 Bacteria 644
55 JGI24703J35330_11677731 3300002501 Bacteria 1782
56 JGI24703J35330_11748856 3300002501 Bacteria 55836
57 Ga0466707_105801 3300042601 Bacteria 10427
58 Ga0466714_149745 3300042603 Bacteria 1302
59 Ga0466698_181967 3300042610 Bacteria 2012
60 Ga0466735_087887 3300042624 Bacteria 2332
61 Ga0466735_206635 3300042624 Bacteria 1529
62 Ga0466702_109721 3300042635 Bacteria 1604
63 Ga0466726_237071 3300042619 Bacteria 1895
64 Ga0123355_10307851 3300009826 Bacteria 2151
65 Ga0123355_10824432 3300009826 Bacteria 1028
66 Ga0123355_10961761 3300009826 Bacteria 915
67 Ga0123356_10000028 3300010049 Bacteria 164875
68 Ga0123356_10168052 3300010049 Bacteria 2200
69 Ga0123356_10397365 3300010049 Bacteria 1515
70 Ga0123356_10977361 3300010049 Bacteria 1017
71 Ga0123356_12013871 3300010049 Bacteria 720
72 Ga0123353_10039036 3300010167 Bacteria 7469
73 Ga0123353_10130696 3300010167 Bacteria 4029
74 Ga0123353_10382260 3300010167 Bacteria 2105
75 Ga0123353_10655149 3300010167 Bacteria 1485
76 JGI24705J35276_12223894 3300002504 Bacteria 2554
77 Ga0466706_073586 3300042599 Bacteria 52445
78 Ga0466719_134861 3300042606 Bacteria 3606
79 Ga0466721_207865 3300042608 Bacteria 2920
80 Ga0466721_359986 3300042608 Bacteria 2131
81 Ga0466697_168754 3300042611 Bacteria 1119
82 Ga0466725_047128 3300042654 Bacteria 3673
83 Ga0466705_519922 3300042612 Bacteria 6917
84 Ga0123355_10099068 3300009826 Bacteria 4594
85 Ga0123356_10265860 3300010049 Bacteria 1802
86 Ga0123356_11184709 3300010049 Unclassified 930
87 Ga0123356_13113502 3300010049 Bacteria 578
88 Ga0123353_10160734 3300010167 Bacteria 3577
89 JGI24700J35501_10929970 3300002508 Bacteria 10835
90 Ga0068305_10105372 3300005083 Bacteria 3452
91 Ga0466707_294631 3300042601 Bacteria 9159
92 Ga0466705_146538 3300042612 Bacteria 158344
93 Ga0123355_10534469 3300009826 Bacteria 1426
94 Ga0123355_11837799 3300009826 Bacteria 569
95 Ga0123356_10050997 3300010049 Bacteria 3849
96 Ga0123356_11558848 3300010049 Bacteria 817
97 2227150556 2225789004 Bacteria 1590
98 Ga0466706_287336 3300042599 Bacteria 1551
99 Ga0466707_057330 3300042601 Bacteria 2236
100 Ga0466724_52409 3300042649 Bacteria 2778
101 Ga0466725_289756 3300042654 Bacteria 2348
102 Ga0123355_10012193 3300009826 Bacteria 13307
103 Ga0123355_10212954 3300009826 Bacteria 2796
104 Ga0123356_10053485 3300010049 Bacteria 3758
105 Ga0123356_10355954 3300010049 Bacteria 1589
106 Ga0123356_10587006 3300010049 Bacteria 1278
107 Ga0123353_10631339 3300010167 Bacteria 1522
108 Ga0123353_11501427 3300010167 Bacteria 858
109 Ga0123353_12564063 3300010167 Bacteria 604
110 Ga0415639_003869 3300038395 Bacteria 4678
111 Ga0466696_180888 3300042596 Bacteria 1000
112 IMNBL1DRAFT_c0001208 3300000062 Bacteria 19538
113 JGI24702J35022_10351797 3300002462 Bacteria 881
114 JGI24703J35330_11516018 3300002501 Bacteria 1148
115 JGI24703J35330_11719314 3300002501 Bacteria 2348
116 Ga0466721_113974 3300042608 Bacteria 1005
117 Ga0466735_067909 3300042624 Bacteria 5465
118 Ga0466724_08985 3300042649 Bacteria 2867
119 Ga0466727_070451 3300042655 Bacteria 6628
120 Ga0123355_10006928 3300009826 Bacteria 16875
121 Ga0123355_10661610 3300009826 Bacteria 1215
122 Ga0123355_10962480 3300009826 Unclassified 914
123 Ga0123355_11546631 3300009826 Bacteria 643
124 Ga0123353_10006370 3300010167 Bacteria 15703
125 Ga0123353_10815776 3300010167 Bacteria 1285
126 Ga0072940_1191708 3300005200 Bacteria 881
127 Ga0466721_159638 3300042608 Bacteria 1229
128 Ga0466705_281367 3300042612 Bacteria 4800
129 Ga0466727_021530 3300042655 Bacteria 2033
130 Ga0466723_374595 3300042618 Bacteria 26188

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00276 Ribosomal_L23 Ribosomal protein L23 15 100 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.