Protein Family IF00862
Metagenome
Metatranscriptome
Isolate
147
Members
77
Samples
125
Scaffolds
156.59
Avg Length
Representative Sequence
- ID
- 3300002501|JGI24703J35330_11533358|JGI24703J35330_115333582
- Length
- 177 aa
- Sequence
- MAVFRRYSTCGFMLSIGGKSVPRKGHVPKRDVLPDPLYTSKVVTKLINCVMLDGKKSTAEGIVYGALDRVSKDKGVPAMEVFEEALSNITPVLEVKARRVGGSTYQVPMEIRPERRQALALRWLVQYARRRGEKTMEERLAKELLDALNNVGGAVKKKEDVHKMAEANRAFAHYKW*
Sample Types
Isolate
15.0%
Metagenome
84.3%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.0%
Unclassified
29.3%
Kalotermitidae
17.3%
Tenebrionidae
4.0%
Rhinotermitidae
2.7%
Hodotermitidae
1.3%
Formicidae
1.3%
Armadillidiidae
1.3%
Apidae
1.3%
Passalidae
1.3%
Cixiidae
1.3%
Drosophilidae
1.3%
Termopsidae
1.3%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 2 | 2820074476 | Unclassified Proteobacteria Nt197P3bin125 | Isolate | Unclassified |
| 3 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 4 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2820067954 | Unclassified Proteobacteria Nt197P3bin44 | Isolate | Unclassified |
| 21 | 2820079308 | Unclassified Proteobacteria Lab288P4bin43 | Isolate | Unclassified |
| 22 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 25 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 26 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 27 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 28 | 2820100407 | Unclassified Proteobacteria Lab288P1bin48 | Isolate | Unclassified |
| 29 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 30 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 2820097052 | Unclassified Proteobacteria Lab288P3bin109 | Isolate | Unclassified |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 48 | 2820154698 | Unclassified Proteobacteria Cu122P5bin26 | Isolate | Unclassified |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 54 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 55 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2820096063 | Unclassified Proteobacteria Lab288P3bin136 | Isolate | Unclassified |
| 62 | 2820097968 | Unclassified Proteobacteria Lab288P3bin104 | Isolate | Unclassified |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 65 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 66 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 67 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 68 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 72 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 73 | 2820064859 | Unclassified Proteobacteria Nt197P3bin78 | Isolate | Unclassified |
| 74 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 75 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_005490 | 3300042602 | Bacteria | 25065 |
| 2 | Ga0466698_343358 | 3300042610 | Unclassified | 2449 |
| 3 | Ga0466690_086048 | 3300042590 | Bacteria | 5389 |
| 4 | Ga0466696_015338 | 3300042596 | Bacteria | 1268 |
| 5 | Ga0466699_325398 | 3300042597 | Bacteria | 4411 |
| 6 | Ga0466705_050795 | 3300042612 | Bacteria | 3744 |
| 7 | Ga0466704_395075 | 3300042643 | Unclassified | 3701 |
| 8 | Ga0466704_594476 | 3300042643 | Bacteria | 1759 |
| 9 | Ga0123353_10252607 | 3300010167 | Bacteria | 2729 |
| 10 | Ga0123353_10279169 | 3300010167 | Bacteria | 2567 |
| 11 | Ga0123354_10410005 | 3300010882 | Unclassified | 1137 |
| 12 | Ga0466705_518333 | 3300042612 | Bacteria | 5775 |
| 13 | Ga0466712_028101 | 3300042614 | Bacteria | 6642 |
| 14 | Ga0466711_304910 | 3300042615 | Bacteria | 15225 |
| 15 | Ga0466723_229883 | 3300042618 | Bacteria | 15885 |
| 16 | Ga0562379_0781 | 3300056790 | Bacteria | 51669 |
| 17 | IMNBL1DRAFT_c0037922 | 3300000062 | Bacteria | 1664 |
| 18 | JGI24705J35276_12098624 | 3300002504 | Bacteria | 1012 |
| 19 | JGI24705J35276_12230600 | 3300002504 | Unclassified | 3677 |
| 20 | Ga0466706_117179 | 3300042599 | Bacteria | 17599 |
| 21 | Ga0466707_017686 | 3300042601 | Bacteria | 186599 |
| 22 | Ga0466690_165306 | 3300042590 | Bacteria | 7409 |
| 23 | Ga0466691_210220 | 3300042593 | Bacteria | 1211 |
| 24 | Ga0466694_063807 | 3300042594 | Unclassified | 4026 |
| 25 | Ga0466699_298718 | 3300042597 | Bacteria | 2824 |
| 26 | Ga0466705_296938 | 3300042612 | Bacteria | 5798 |
| 27 | Ga0466734_079104 | 3300042623 | Unclassified | 1527 |
| 28 | Ga0466703_265291 | 3300042636 | Bacteria | 1863 |
| 29 | Ga0466709_379753 | 3300042648 | Bacteria | 47793 |
| 30 | Ga0123357_10276885 | 3300009784 | Bacteria | 1741 |
| 31 | Ga0123355_10322198 | 3300009826 | Bacteria | 2081 |
| 32 | Ga0123353_10000370 | 3300010167 | Bacteria | 55114 |
| 33 | Ga0466710_365847 | 3300042613 | Unclassified | 2503 |
| 34 | Ga0466726_220528 | 3300042619 | Bacteria | 5365 |
| 35 | Ga0466732_048277 | 3300042656 | Bacteria | 1824 |
| 36 | Ga0562378_0032 | 3300056814 | Bacteria | 502759 |
| 37 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 38 | Ga0466714_062448 | 3300042603 | Bacteria | 5091 |
| 39 | Ga0466716_040043 | 3300042605 | Bacteria | 2589 |
| 40 | Ga0466716_077310 | 3300042605 | Bacteria | 14234 |
| 41 | Ga0466657_127756 | 3300042582 | Bacteria | 1042 |
| 42 | Ga0466691_033207 | 3300042593 | Bacteria | 12070 |
| 43 | Ga0466696_024651 | 3300042596 | Bacteria | 9366 |
| 44 | Ga0123357_10427023 | 3300009784 | Bacteria | 1175 |
| 45 | Ga0123355_10227905 | 3300009826 | Bacteria | 2667 |
| 46 | Ga0123356_11357571 | 3300010049 | Bacteria | 872 |
| 47 | Ga0123353_10146007 | 3300010167 | Bacteria | 3782 |
| 48 | Ga0123353_10156290 | 3300010167 | Bacteria | 3634 |
| 49 | Ga0123354_10031973 | 3300010882 | Bacteria | 8254 |
| 50 | Ga0466723_053886 | 3300042618 | Bacteria | 38136 |
| 51 | Ga0466728_154220 | 3300042620 | Bacteria | 18005 |
| 52 | Ga0072941_1001152 | 3300005201 | Bacteria | 56124 |
| 53 | Ga0466717_262745 | 3300042604 | Bacteria | 1574 |
| 54 | Ga0466722_007995 | 3300042609 | Bacteria | 2765 |
| 55 | Ga0466690_227212 | 3300042590 | Bacteria | 7606 |
| 56 | Ga0466693_107613 | 3300042592 | Bacteria | 2579 |
| 57 | Ga0466693_298058 | 3300042592 | Bacteria | 1346 |
| 58 | Ga0466705_126678 | 3300042612 | Bacteria | 2706 |
| 59 | Ga0466730_003020 | 3300042625 | Bacteria | 3396 |
| 60 | Ga0123355_10495489 | 3300009826 | Bacteria | 1511 |
| 61 | Ga0123353_10188983 | 3300010167 | Unclassified | 3253 |
| 62 | Ga0123353_11408549 | 3300010167 | Bacteria | 895 |
| 63 | Ga0123354_10221170 | 3300010882 | Bacteria | 2011 |
| 64 | Ga0466723_070468 | 3300042618 | Bacteria | 6146 |
| 65 | Ga0074309_1097101 | 3300005314 | Bacteria | 1598 |
| 66 | Ga0466706_006549 | 3300042599 | Bacteria | 7764 |
| 67 | Ga0466706_137934 | 3300042599 | Bacteria | 2723 |
| 68 | Ga0466714_015966 | 3300042603 | Unclassified | 6634 |
| 69 | Ga0466716_428855 | 3300042605 | Bacteria | 3633 |
| 70 | Ga0415639_108789 | 3300038395 | Bacteria | 1304 |
| 71 | Ga0466731_193598 | 3300042622 | Unclassified | 1130 |
| 72 | Ga0123356_10427215 | 3300010049 | Bacteria | 1468 |
| 73 | Ga0123356_10872973 | 3300010049 | Bacteria | 1071 |
| 74 | Ga0123353_10772178 | 3300010167 | Bacteria | 1333 |
| 75 | Ga0466715_384662 | 3300042616 | Bacteria | 8076 |
| 76 | Ga0466700_106333 | 3300042600 | Bacteria | 7864 |
| 77 | Ga0466700_230322 | 3300042600 | Bacteria | 1068 |
| 78 | Ga0466707_079742 | 3300042601 | Bacteria | 2139 |
| 79 | Ga0466690_024465 | 3300042590 | Bacteria | 8908 |
| 80 | Ga0466690_102435 | 3300042590 | Bacteria | 2118 |
| 81 | Ga0466690_313050 | 3300042590 | Bacteria | 12844 |
| 82 | Ga0466692_150894 | 3300042591 | Bacteria | 2213 |
| 83 | Ga0466694_274927 | 3300042594 | Bacteria | 1148 |
| 84 | Ga0466695_329798 | 3300042595 | Unclassified | 8946 |
| 85 | Ga0466696_429858 | 3300042596 | Bacteria | 2327 |
| 86 | Ga0466705_021542 | 3300042612 | Bacteria | 13866 |
| 87 | Ga0466705_208154 | 3300042612 | Bacteria | 3946 |
| 88 | Ga0123357_10359287 | 3300009784 | Bacteria | 1381 |
| 89 | Ga0123357_10581234 | 3300009784 | Bacteria | 872 |
| 90 | Ga0123353_10000006 | 3300010167 | Bacteria | 279423 |
| 91 | Ga0466733_207242 | 3300042659 | Bacteria | 1230 |
| 92 | Ga0466714_073420 | 3300042603 | Bacteria | 11760 |
| 93 | Ga0466716_322807 | 3300042605 | Bacteria | 1334 |
| 94 | Ga0255808_1005302 | 3300023282 | Bacteria | 1093 |
| 95 | Ga0265387_1008691 | 3300024582 | Bacteria | 1367 |
| 96 | Ga0466691_061789 | 3300042593 | Bacteria | 1005 |
| 97 | Ga0466696_216499 | 3300042596 | Bacteria | 1885 |
| 98 | Ga0466705_369982 | 3300042612 | Bacteria | 4229 |
| 99 | Ga0466704_560178 | 3300042643 | Bacteria | 28918 |
| 100 | Ga0466708_172193 | 3300042652 | Bacteria | 7652 |
| 101 | Ga0466725_053595 | 3300042654 | Bacteria | 1010 |
| 102 | Ga0123355_10004356 | 3300009826 | Bacteria | 20581 |
| 103 | Ga0123355_10010483 | 3300009826 | Bacteria | 14209 |
| 104 | Ga0123356_10134312 | 3300010049 | Bacteria | 2429 |
| 105 | Ga0123356_11420962 | 3300010049 | Bacteria | 854 |
| 106 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 107 | Ga0123353_10117221 | 3300010167 | Bacteria | 4284 |
| 108 | Ga0123353_10354889 | 3300010167 | Bacteria | 2207 |
| 109 | Ga0123353_11733331 | 3300010167 | Bacteria | 780 |
| 110 | Ga0466728_269300 | 3300042620 | Bacteria | 1064 |
| 111 | JGI24703J35330_11533358 | 3300002501 | Bacteria | 1185 |
| 112 | Ga0068305_11121791 | 3300005083 | Bacteria | 885 |
| 113 | Ga0466714_079254 | 3300042603 | Unclassified | 1779 |
| 114 | Ga0466714_116642 | 3300042603 | Bacteria | 5549 |
| 115 | Ga0466720_158376 | 3300042607 | Bacteria | 2512 |
| 116 | Ga0160457_1000015 | 3300012858 | Bacteria | 420875 |
| 117 | Ga0466657_182514 | 3300042582 | Unclassified | 5213 |
| 118 | Ga0466694_237465 | 3300042594 | Bacteria | 1167 |
| 119 | Ga0466696_250731 | 3300042596 | Bacteria | 4384 |
| 120 | Ga0123353_11141300 | 3300010167 | Bacteria | 1030 |
| 121 | Ga0466723_154869 | 3300042618 | Bacteria | 18650 |
| 122 | Ga0466728_290658 | 3300042620 | Bacteria | 41498 |
| 123 | IMNBL1DRAFT_c0000271 | 3300000062 | Bacteria | 45868 |
| 124 | Ga0072941_1533888 | 3300005201 | Bacteria | 1899 |
| 125 | Ga0102740_1000020 | 3300007140 | Bacteria | 39421 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00177 | Ribosomal_S7 | Ribosomal protein S7p/S5e | 22 | 169 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.