Protein Family IF00818

Metagenome Isolate
114 Members
39 Samples
111 Scaffolds
360.46 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10132615|JGI24702J35022_101326151
Length
402 aa
Sequence
MVLGGNWRSERQQKRLILFDKSGVLAYNTLMNENMKLLIQSAGRTPDPRCQTRNFRHKLCDILVIAFCAIICGAESYADLELFGKFRQLWLSMYLELPNGIPNADTFQRVFEIVDSAAVAKALRKILTPEDFVARVVAFDGKTQRSSKKGKRRAWHTLSAYLTDAQIVLGEVICDEKSNEITAIPELLDTLNVEKAIVTIDAMGAQTKIAEKIVEKKADYVLALKGNQADLFDDVRFYLDNEQVPRLEIYDPKQRHGRQEKREYFLETNIDWLHNRENWAGLSAIGAVKSTVTEKGETRIETRYFLTSLISLEDFARAVRAHWGIENKLHWHLDVTFNEDASRVRNRNATQVWNILRKTALEHLKSLNNKKYSLKALRKGCGWSNDLLLHTLFGNEMPAQF*

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 71.8%
Kalotermitidae 10.3%
Unclassified 7.7%
Passalidae 5.1%
Hodotermitidae 2.6%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 4
Bacteria 97
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190992 Unclassified Bathyarchaeota Emb289P3bin80 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10074237 3300009826 Bacteria 5448
2 Ga0123355_10481012 3300009826 Unclassified 1545
3 Ga0123355_10551182 3300009826 Bacteria 1394
4 Ga0123356_10079579 3300010049 Bacteria 3096
5 Ga0123356_10286708 3300010049 Bacteria 1745
6 Ga0123353_10248656 3300010167 Bacteria 2756
7 Ga0466656_117447 3300042550 Bacteria 1808
8 Ga0466656_244950 3300042550 Bacteria 1347
9 Ga0466699_046166 3300042597 Bacteria 2469
10 Ga0466731_026497 3300042622 Bacteria 1439
11 Ga0466725_016409 3300042654 Bacteria 1511
12 JGI24702J35022_10132615 3300002462 Bacteria 1384
13 JGI24703J35330_11603011 3300002501 Bacteria 1382
14 Ga0466706_188051 3300042599 Bacteria 1933
15 Ga0123357_10244666 3300009784 Bacteria 1934
16 Ga0123357_10371663 3300009784 Bacteria 1339
17 Ga0123355_10065643 3300009826 Bacteria 5845
18 Ga0123356_10417897 3300010049 Unclassified 1482
19 Ga0123356_10438765 3300010049 Bacteria 1452
20 Ga0415639_045250 3300038395 Bacteria 1916
21 Ga0466657_236870 3300042582 Bacteria 1682
22 Ga0466694_174229 3300042594 Unclassified 1312
23 Ga0466699_301110 3300042597 Bacteria 1646
24 Ga0466705_526883 3300042612 Bacteria 1714
25 Ga0466725_162271 3300042654 Bacteria 1357
26 Ga0466725_263944 3300042654 Bacteria 2503
27 JGI24696J40584_12957441 3300002834 Bacteria 3516
28 Ga0466706_162749 3300042599 Bacteria 1449
29 Ga0466707_383986 3300042601 Bacteria 4437
30 Ga0466721_322711 3300042608 Bacteria 3635
31 Ga0123353_10564373 3300010167 Bacteria 1638
32 Ga0123353_10574137 3300010167 Bacteria 1620
33 Ga0415639_026989 3300038395 Bacteria 3199
34 Ga0466656_053819 3300042550 Bacteria 1896
35 Ga0466693_250684 3300042592 Bacteria 1475
36 Ga0466696_153890 3300042596 Bacteria 3672
37 Ga0466699_125347 3300042597 Archaea 2051
38 Ga0466731_280449 3300042622 Bacteria 1331
39 Ga0466702_249119 3300042635 Unclassified 1787
40 JGI24702J35022_10124363 3300002462 Bacteria 1427
41 JGI24705J35276_12195666 3300002504 Bacteria 1528
42 Ga0466706_224972 3300042599 Bacteria 1444
43 Ga0466707_125820 3300042601 Bacteria 1814
44 Ga0466733_201690 3300042659 Bacteria 1416
45 Ga0123357_10324101 3300009784 Bacteria 1517
46 Ga0123355_10051575 3300009826 Bacteria 6676
47 Ga0123356_10074617 3300010049 Bacteria 3192
48 Ga0123356_10358714 3300010049 Bacteria 1584
49 Ga0123356_10548927 3300010049 Bacteria 1316
50 Ga0123354_10312392 3300010882 Bacteria 1465
51 Ga0466693_019092 3300042592 Bacteria 2396
52 Ga0466694_259155 3300042594 Bacteria 1395
53 Ga0466705_502944 3300042612 Bacteria 1416
54 Ga0466710_427793 3300042613 Bacteria 2292
55 Ga0466726_353822 3300042619 Bacteria 1225
56 Ga0466703_310154 3300042636 Bacteria 1730
57 Ga0466725_253649 3300042654 Bacteria 1323
58 Ga0466700_141140 3300042600 Bacteria 2206
59 Ga0466700_205786 3300042600 Bacteria 1545
60 Ga0466714_009066 3300042603 Bacteria 1848
61 Ga0466717_106655 3300042604 Bacteria 1290
62 Ga0123355_10313776 3300009826 Bacteria 2121
63 Ga0123355_10434207 3300009826 Bacteria 1668
64 Ga0123356_10288305 3300010049 Bacteria 1741
65 Ga0123356_10361855 3300010049 Bacteria 1578
66 Ga0123354_10279277 3300010882 Bacteria 1626
67 Ga0123354_10298962 3300010882 Bacteria 1527
68 Ga0466693_356764 3300042592 Unclassified 1810
69 Ga0466731_103793 3300042622 Bacteria 12932
70 Ga0466731_133741 3300042622 Unclassified 1951
71 Ga0466725_411778 3300042654 Bacteria 2066
72 2227336640 2225789004 Bacteria 1164
73 Ga0123355_10564422 3300009826 Archaea 1369
74 Ga0123356_10494592 3300010049 Bacteria 1378
75 Ga0123354_10342943 3300010882 Bacteria 1344
76 Ga0466656_057519 3300042550 Bacteria 1243
77 Ga0466693_421475 3300042592 Unclassified 2448
78 Ga0466705_411109 3300042612 Bacteria 1789
79 Ga0466731_293015 3300042622 Bacteria 1691
80 JGI24699J35502_10965071 3300002509 Bacteria 1216
81 JGI24696J40584_12914661 3300002834 Bacteria 1287
82 JGI24696J40584_12947173 3300002834 Bacteria 1934
83 Ga0466706_184052 3300042599 Bacteria 2473
84 Ga0466714_017864 3300042603 Bacteria 1533
85 Ga0466697_129981 3300042611 Unclassified 2713
86 Ga0123356_10000746 3300010049 Bacteria 35955
87 Ga0123356_10565229 3300010049 Bacteria 1299
88 Ga0123353_10450422 3300010167 Bacteria 1895
89 Ga0123354_10321556 3300010882 Bacteria 1427
90 Ga0466699_051646 3300042597 Bacteria 1809
91 Ga0466710_400228 3300042613 Unclassified 1358
92 Ga0466731_192193 3300042622 Bacteria 2622
93 Ga0466731_265801 3300042622 Bacteria 1399
94 Ga0466734_005140 3300042623 Bacteria 1389
95 Ga0466734_104873 3300042623 Unclassified 1727
96 JGI24696J40584_12932688 3300002834 Bacteria 1506
97 Ga0072940_1244658 3300005200 Bacteria 5853
98 Ga0466700_143159 3300042600 Bacteria 2310
99 Ga0466714_157089 3300042603 Bacteria 1184
100 Ga0466717_057573 3300042604 Bacteria 1526
101 Ga0466717_114623 3300042604 Unclassified 1690
102 Ga0466717_203161 3300042604 Bacteria 1789
103 Ga0466705_292968 3300042612 Bacteria 43689
104 Ga0123356_10182299 3300010049 Unclassified 2123
105 Ga0123356_10624558 3300010049 Bacteria 1243
106 Ga0123354_10227638 3300010882 Bacteria 1959
107 Ga0415639_100938 3300038395 Bacteria 1454
108 Ga0466715_108849 3300042616 Bacteria 11258
109 IMNBL1DRAFT_c0059112 3300000062 Bacteria 1161
110 JGI24703J35330_11559850 3300002501 Unclassified 1250
111 Ga0466717_144400 3300042604 Bacteria 1591

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042603 Ga0466714_157089 Ga0466714_157089_43_951 302
2 3300042592 Ga0466693_250684 Ga0466693_250684_178_1089 303
3 3300042601 Ga0466707_383986 Ga0466707_383986_228_1145 305
4 3300042594 Ga0466694_259155 Ga0466694_259155_221_1144 307
5 3300010167 Ga0123353_10564373 Ga0123353_105643732 308
6 3300042550 Ga0466656_057519 Ga0466656_057519_55_996 313
7 iso_pu_archaea 2772190992 2773785444 316
8 3300010049 Ga0123356_10079579 Ga0123356_100795792 317
9 3300010167 Ga0123353_10450422 Ga0123353_104504222 329
10 3300042623 Ga0466734_005140 Ga0466734_005140_95_1087 330
11 3300042613 Ga0466710_400228 Ga0466710_400228_274_1275 333
12 3300042622 Ga0466731_280449 Ga0466731_280449_54_1058 334
13 3300009784 Ga0123357_10371663 Ga0123357_103716632 338
14 3300005200 Ga0072940_1244658 Ga0072940_12446582 339
15 3300042622 Ga0466731_133741 Ga0466731_133741_246_1271 341
16 3300038395 Ga0415639_026989 Ga0415639_026989_271_1308 345
17 3300042603 Ga0466714_009066 Ga0466714_009066_351_1457 345
18 3300042622 Ga0466731_192193 Ga0466731_192193_1059_2174 346
19 3300042622 Ga0466731_265801 Ga0466731_265801_320_1360 346
20 3300000062 IMNBL1DRAFT_c0059112 IMNBL1DRAFT_00591121 348
21 3300009784 Ga0123357_10244666 Ga0123357_102446662 354
22 3300042622 Ga0466731_293015 Ga0466731_293015_89_1189 354
23 3300042597 Ga0466699_051646 Ga0466699_051646_329_1396 355
24 3300002834 JGI24696J40584_12957441 JGI24696J40584_129574414 359
25 3300042582 Ga0466657_236870 Ga0466657_236870_296_1414 359
26 3300042592 Ga0466693_421475 Ga0466693_421475_1119_2222 359
27 3300009784 Ga0123357_10324101 Ga0123357_103241011 360
28 3300010882 Ga0123354_10312392 Ga0123354_103123921 360
29 3300042604 Ga0466717_057573 Ga0466717_057573_136_1221 361
30 3300042604 Ga0466717_144400 Ga0466717_144400_272_1357 361
31 3300042611 Ga0466697_129981 Ga0466697_129981_992_2077 361
32 3300042623 Ga0466734_104873 Ga0466734_104873_301_1386 361
33 3300010049 Ga0123356_10494592 Ga0123356_104945921 362
34 3300010882 Ga0123354_10321556 Ga0123354_103215561 362
35 3300042612 Ga0466705_502944 Ga0466705_502944_318_1406 362
36 3300042622 Ga0466731_103793 Ga0466731_103793_43_1131 362
37 3300010049 Ga0123356_10417897 Ga0123356_104178971 363
38 3300010049 Ga0123356_10548927 Ga0123356_105489272 363
39 3300042594 Ga0466694_174229 Ga0466694_174229_25_1116 363
40 3300042597 Ga0466699_301110 Ga0466699_301110_271_1362 363
41 3300042604 Ga0466717_203161 Ga0466717_203161_390_1481 363
42 3300042608 Ga0466721_322711 Ga0466721_322711_393_1484 363
43 2225789004 2227336640 2227784068 364
44 3300009826 Ga0123355_10481012 Ga0123355_104810121 364
45 3300010167 Ga0123353_10248656 Ga0123353_102486562 364
46 3300010882 Ga0123354_10227638 Ga0123354_102276382 364
47 3300010882 Ga0123354_10279277 Ga0123354_102792771 364
48 3300042550 Ga0466656_244950 Ga0466656_244950_117_1211 364
49 3300042596 Ga0466696_153890 Ga0466696_153890_820_1914 364
50 3300042599 Ga0466706_224972 Ga0466706_224972_89_1183 364
51 3300042612 Ga0466705_292968 Ga0466705_292968_18692_19786 364
52 3300042619 Ga0466726_353822 Ga0466726_353822_105_1199 364
53 3300042654 Ga0466725_162271 Ga0466725_162271_140_1234 364
54 3300042654 Ga0466725_411778 Ga0466725_411778_506_1600 364
55 iso_pr_bacteria 2820296961 2820298241 364
56 3300010167 Ga0123353_10574137 Ga0123353_105741371 365
57 3300042599 Ga0466706_184052 Ga0466706_184052_754_1851 365
58 3300042659 Ga0466733_201690 Ga0466733_201690_86_1183 365
59 3300042600 Ga0466700_143159 Ga0466700_143159_672_1772 366
60 3300042612 Ga0466705_411109 Ga0466705_411109_455_1558 367
61 3300042613 Ga0466710_427793 Ga0466710_427793_186_1289 367
62 3300002834 JGI24696J40584_12914661 JGI24696J40584_129146611 368
63 3300009826 Ga0123355_10434207 Ga0123355_104342072 368
64 3300009826 Ga0123355_10564422 Ga0123355_105644221 368
65 3300010049 Ga0123356_10438765 Ga0123356_104387652 368
66 3300010049 Ga0123356_10565229 Ga0123356_105652291 368
67 3300042550 Ga0466656_053819 Ga0466656_053819_751_1857 368
68 3300042592 Ga0466693_356764 Ga0466693_356764_560_1666 368
69 3300042597 Ga0466699_046166 Ga0466699_046166_481_1587 368
70 3300042600 Ga0466700_205786 Ga0466700_205786_356_1462 368
71 3300042612 Ga0466705_526883 Ga0466705_526883_553_1659 368
72 3300042635 Ga0466702_249119 Ga0466702_249119_221_1327 368
73 3300042636 Ga0466703_310154 Ga0466703_310154_320_1426 368
74 3300042654 Ga0466725_253649 Ga0466725_253649_110_1216 368
75 3300042654 Ga0466725_263944 Ga0466725_263944_1134_2240 368
76 3300002462 JGI24702J35022_10124363 JGI24702J35022_101243631 369
77 3300002501 JGI24703J35330_11559850 JGI24703J35330_115598501 369
78 3300002504 JGI24705J35276_12195666 JGI24705J35276_121956662 369
79 3300009826 Ga0123355_10313776 Ga0123355_103137762 369
80 3300010049 Ga0123356_10182299 Ga0123356_101822992 369
81 3300010049 Ga0123356_10624558 Ga0123356_106245581 369
82 3300010882 Ga0123354_10298962 Ga0123354_102989621 369
83 3300010882 Ga0123354_10342943 Ga0123354_103429431 369
84 3300042599 Ga0466706_162749 Ga0466706_162749_35_1144 369
85 3300042599 Ga0466706_188051 Ga0466706_188051_631_1740 369
86 3300009826 Ga0123355_10065643 Ga0123355_100656433 370
87 3300042597 Ga0466699_125347 Ga0466699_125347_757_1869 370
88 3300042604 Ga0466717_106655 Ga0466717_106655_110_1222 370
89 3300042622 Ga0466731_026497 Ga0466731_026497_217_1329 370
90 iso_pu_archaea 2772190992 2773783802 370
91 3300009826 Ga0123355_10051575 Ga0123355_100515752 371
92 3300010049 Ga0123356_10000746 Ga0123356_1000074610 371
93 3300010049 Ga0123356_10286708 Ga0123356_102867081 371
94 3300010049 Ga0123356_10288305 Ga0123356_102883052 372
95 3300010049 Ga0123356_10358714 Ga0123356_103587141 372
96 3300010049 Ga0123356_10361855 Ga0123356_103618551 372
97 3300042550 Ga0466656_117447 Ga0466656_117447_530_1648 372
98 3300042592 Ga0466693_019092 Ga0466693_019092_811_1929 372
99 3300042600 Ga0466700_141140 Ga0466700_141140_1004_2122 372
100 3300042604 Ga0466717_114623 Ga0466717_114623_110_1231 373
101 3300042616 Ga0466715_108849 Ga0466715_108849_8251_9372 373
102 3300002501 JGI24703J35330_11603011 JGI24703J35330_116030112 374
103 3300002834 JGI24696J40584_12932688 JGI24696J40584_129326882 374
104 3300009826 Ga0123355_10074237 Ga0123355_100742371 374
105 3300038395 Ga0415639_045250 Ga0415639_045250_160_1284 374
106 3300002509 JGI24699J35502_10965071 JGI24699J35502_109650711 375
107 3300002834 JGI24696J40584_12947173 JGI24696J40584_129471732 375
108 3300010049 Ga0123356_10074617 Ga0123356_100746172 375
109 3300042601 Ga0466707_125820 Ga0466707_125820_560_1687 375
110 3300042654 Ga0466725_016409 Ga0466725_016409_142_1272 376
111 3300009826 Ga0123355_10551182 Ga0123355_105511821 377
112 3300042603 Ga0466714_017864 Ga0466714_017864_175_1383 377
113 3300038395 Ga0415639_100938 Ga0415639_100938_283_1425 380
114 3300002462 JGI24702J35022_10132615 JGI24702J35022_101326151 402

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13808 DDE_Tnp_1_assoc DDE_Tnp_1-associated 44 125 0.94
PF01609 DDE_Tnp_1 Transposase DDE domain 135 361 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.