Protein Family IF00813
Metagenome
Isolate
276
Members
71
Samples
269
Scaffolds
66.11
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10093726|JGI24702J35022_100937263
- Length
- 81 aa
- Sequence
- MKIKEVRELSTKEIEERIDAEEMSLEQKKINHSISPLDNPQTIKEQRRTIARLKTELRVRLCRYPLYATSGPGVGTYLPG*
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.9%
Kalotermitidae
20.0%
Unclassified
12.9%
Termopsidae
5.7%
Rhinotermitidae
4.3%
Passalidae
2.9%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
250
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 39 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 48 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 63 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 64 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 65 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 66 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 67 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 71 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_209475 | 3300038395 | Bacteria | 1318 |
| 2 | Ga0466656_294116 | 3300042550 | Bacteria | 2279 |
| 3 | Ga0466657_239926 | 3300042582 | Bacteria | 1113 |
| 4 | Ga0466690_248799 | 3300042590 | Bacteria | 9265 |
| 5 | Ga0466692_138892 | 3300042591 | Bacteria | 2469 |
| 6 | Ga0466693_405521 | 3300042592 | Unclassified | 1268 |
| 7 | Ga0123356_11518542 | 3300010049 | Unclassified | 827 |
| 8 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 9 | Ga0466701_033592 | 3300042598 | Bacteria | 1186 |
| 10 | Ga0466707_230802 | 3300042601 | Bacteria | 16904 |
| 11 | Ga0466707_372914 | 3300042601 | Bacteria | 4317 |
| 12 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 13 | Ga0466719_025390 | 3300042606 | Bacteria | 13141 |
| 14 | Ga0466722_129428 | 3300042609 | Bacteria | 3744 |
| 15 | Ga0466722_175291 | 3300042609 | Bacteria | 6835 |
| 16 | IMNBL1DRAFT_c0049412 | 3300000062 | Bacteria | 1341 |
| 17 | JGI24695J34938_10021047 | 3300002450 | Bacteria | 3199 |
| 18 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 19 | JGI24702J35022_10427277 | 3300002462 | Bacteria | 804 |
| 20 | Ga0466731_173945 | 3300042622 | Bacteria | 1284 |
| 21 | Ga0466735_138676 | 3300042624 | Unclassified | 1195 |
| 22 | Ga0466704_134293 | 3300042643 | Bacteria | 13368 |
| 23 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
| 24 | Ga0466724_68870 | 3300042649 | Bacteria | 1283 |
| 25 | Ga0466711_248608 | 3300042615 | Bacteria | 5371 |
| 26 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 27 | Ga0466697_060711 | 3300042611 | Bacteria | 1892 |
| 28 | Ga0466705_375992 | 3300042612 | Bacteria | 6956 |
| 29 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 30 | Ga0466733_043260 | 3300042659 | Bacteria | 38032 |
| 31 | Ga0466656_221111 | 3300042550 | Bacteria | 1253 |
| 32 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 33 | Ga0466699_054231 | 3300042597 | Bacteria | 7834 |
| 34 | Ga0123357_10005900 | 3300009784 | Bacteria | 14780 |
| 35 | Ga0123357_10030639 | 3300009784 | Bacteria | 7293 |
| 36 | Ga0123357_10860968 | 3300009784 | Bacteria | 596 |
| 37 | Ga0123356_10228329 | 3300010049 | Bacteria | 1924 |
| 38 | Ga0123354_10040605 | 3300010882 | Bacteria | 7198 |
| 39 | Ga0123354_10555185 | 3300010882 | Unclassified | 864 |
| 40 | Ga0123354_10764928 | 3300010882 | Unclassified | 658 |
| 41 | Ga0466707_236982 | 3300042601 | Bacteria | 2451 |
| 42 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 43 | Ga0466721_047383 | 3300042608 | Bacteria | 1346 |
| 44 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 45 | 2227522645 | 2225789004 | Bacteria | 658 |
| 46 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 47 | JGI24702J35022_10093726 | 3300002462 | Bacteria | 1637 |
| 48 | Ga0068302_10187713 | 3300005071 | Bacteria | 5235 |
| 49 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 50 | Ga0072941_1102373 | 3300005201 | Bacteria | 3441 |
| 51 | Ga0466731_092452 | 3300042622 | Bacteria | 1055 |
| 52 | Ga0466731_180586 | 3300042622 | Bacteria | 2122 |
| 53 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 54 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 55 | Ga0466704_113927 | 3300042643 | Bacteria | 2458 |
| 56 | Ga0466727_229366 | 3300042655 | Bacteria | 3254 |
| 57 | Ga0466727_289772 | 3300042655 | Bacteria | 14123 |
| 58 | Ga0466710_347724 | 3300042613 | Bacteria | 2111 |
| 59 | Ga0466715_128269 | 3300042616 | Bacteria | 2365 |
| 60 | Ga0466726_064923 | 3300042619 | Bacteria | 35500 |
| 61 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 62 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 63 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 64 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 65 | Ga0466692_027982 | 3300042591 | Bacteria | 60830 |
| 66 | Ga0466692_126414 | 3300042591 | Bacteria | 5610 |
| 67 | Ga0466691_003678 | 3300042593 | Bacteria | 14150 |
| 68 | Ga0466699_369412 | 3300042597 | Bacteria | 1600 |
| 69 | Ga0123356_11740913 | 3300010049 | Bacteria | 774 |
| 70 | Ga0123356_12869912 | 3300010049 | Unclassified | 603 |
| 71 | Ga0466707_026195 | 3300042601 | Bacteria | 1679 |
| 72 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 73 | JGI24702J35022_10023308 | 3300002462 | Bacteria | 3347 |
| 74 | JGI24705J35276_11366870 | 3300002504 | Bacteria | 518 |
| 75 | JGI24705J35276_11516118 | 3300002504 | Unclassified | 562 |
| 76 | JGI24705J35276_12234796 | 3300002504 | Bacteria | 5858 |
| 77 | Ga0068305_10061301 | 3300005083 | Bacteria | 11640 |
| 78 | Ga0466734_111359 | 3300042623 | Unclassified | 2749 |
| 79 | Ga0466735_041724 | 3300042624 | Bacteria | 21992 |
| 80 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 81 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 82 | Ga0466705_525713 | 3300042612 | Bacteria | 1726 |
| 83 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 84 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 85 | Ga0466729_167874 | 3300042621 | Bacteria | 5275 |
| 86 | Ga0466697_214481 | 3300042611 | Bacteria | 1018 |
| 87 | Ga0466694_170572 | 3300042594 | Bacteria | 1323 |
| 88 | Ga0466696_206041 | 3300042596 | Bacteria | 1521 |
| 89 | Ga0466696_258054 | 3300042596 | Bacteria | 5053 |
| 90 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 91 | Ga0123355_11604869 | 3300009826 | Bacteria | 626 |
| 92 | Ga0123356_10396668 | 3300010049 | Bacteria | 1516 |
| 93 | Ga0466706_149351 | 3300042599 | Bacteria | 2494 |
| 94 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 95 | Ga0466716_141317 | 3300042605 | Bacteria | 3572 |
| 96 | Ga0466719_287899 | 3300042606 | Bacteria | 12579 |
| 97 | Ga0466697_012625 | 3300042611 | Bacteria | 1136 |
| 98 | 2227523052 | 2225789004 | Bacteria | 657 |
| 99 | 2227548142 | 2225789004 | Unclassified | 587 |
| 100 | JGI24698J34947_10051090 | 3300002449 | Bacteria | 2081 |
| 101 | JGI24702J35022_10653239 | 3300002462 | Bacteria | 652 |
| 102 | JGI24696J40584_12851921 | 3300002834 | Bacteria | 984 |
| 103 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 104 | Ga0072941_1219958 | 3300005201 | Bacteria | 2247 |
| 105 | Ga0466735_083736 | 3300042624 | Bacteria | 2398 |
| 106 | Ga0466735_115245 | 3300042624 | Bacteria | 1131 |
| 107 | Ga0466735_180421 | 3300042624 | Bacteria | 2530 |
| 108 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 109 | Ga0466704_586207 | 3300042643 | Unclassified | 1342 |
| 110 | Ga0466712_183753 | 3300042614 | Unclassified | 1486 |
| 111 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 112 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 113 | Ga0466715_643493 | 3300042616 | Bacteria | 6621 |
| 114 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 115 | Ga0466728_071780 | 3300042620 | Bacteria | 4317 |
| 116 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 117 | Ga0466656_362907 | 3300042550 | Bacteria | 1931 |
| 118 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 119 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 120 | Ga0466694_145437 | 3300042594 | Unclassified | 1026 |
| 121 | Ga0123357_10505100 | 3300009784 | Bacteria | 1000 |
| 122 | Ga0123353_11058130 | 3300010167 | Unclassified | 1083 |
| 123 | Ga0123353_13029665 | 3300010167 | Bacteria | 543 |
| 124 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 125 | Ga0466700_314910 | 3300042600 | Bacteria | 2121 |
| 126 | Ga0466719_504884 | 3300042606 | Bacteria | 4012 |
| 127 | JGI24698J34947_10057894 | 3300002449 | Unclassified | 1921 |
| 128 | JGI24702J35022_10000437 | 3300002462 | Bacteria | 25160 |
| 129 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 130 | JGI24702J35022_10379029 | 3300002462 | Bacteria | 851 |
| 131 | JGI24696J40584_12396143 | 3300002834 | Bacteria | 553 |
| 132 | JGI24696J40584_12654236 | 3300002834 | Unclassified | 696 |
| 133 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 134 | Ga0072940_1052571 | 3300005200 | Bacteria | 1593 |
| 135 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 136 | Ga0466735_001604 | 3300042624 | Unclassified | 1810 |
| 137 | Ga0466703_174375 | 3300042636 | Bacteria | 10269 |
| 138 | Ga0466704_458324 | 3300042643 | Unclassified | 1342 |
| 139 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 140 | Ga0466710_159503 | 3300042613 | Bacteria | 1301 |
| 141 | Ga0466710_191652 | 3300042613 | Bacteria | 1018 |
| 142 | Ga0466710_200734 | 3300042613 | Bacteria | 4049 |
| 143 | Ga0466711_137993 | 3300042615 | Bacteria | 2912 |
| 144 | Ga0466723_198099 | 3300042618 | Bacteria | 9283 |
| 145 | Ga0466726_320805 | 3300042619 | Bacteria | 1920 |
| 146 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 147 | Ga0466728_294355 | 3300042620 | Bacteria | 3426 |
| 148 | Ga0466697_159296 | 3300042611 | Bacteria | 2288 |
| 149 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 150 | Ga0466657_311799 | 3300042582 | Unclassified | 1365 |
| 151 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 152 | Ga0466692_137912 | 3300042591 | Bacteria | 2313 |
| 153 | Ga0466694_199604 | 3300042594 | Bacteria | 2884 |
| 154 | Ga0466695_118348 | 3300042595 | Bacteria | 1207 |
| 155 | Ga0466696_053373 | 3300042596 | Bacteria | 10309 |
| 156 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 157 | Ga0123354_10335090 | 3300010882 | Bacteria | 1373 |
| 158 | Ga0123354_10764930 | 3300010882 | Bacteria | 658 |
| 159 | Ga0466706_090799 | 3300042599 | Bacteria | 1368 |
| 160 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 161 | Ga0466717_104945 | 3300042604 | Bacteria | 7422 |
| 162 | Ga0466717_235136 | 3300042604 | Unclassified | 1031 |
| 163 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 164 | Ga0466719_102248 | 3300042606 | Bacteria | 3149 |
| 165 | Ga0466698_327264 | 3300042610 | Bacteria | 8551 |
| 166 | Ga0466698_392141 | 3300042610 | Bacteria | 2397 |
| 167 | IMNBL1DRAFT_c0004898 | 3300000062 | Bacteria | 7855 |
| 168 | JGI24702J35022_10015205 | 3300002462 | Bacteria | 4239 |
| 169 | JGI24702J35022_10078783 | 3300002462 | Bacteria | 1783 |
| 170 | JGI24702J35022_10925438 | 3300002462 | Unclassified | 543 |
| 171 | JGI24705J35276_11829900 | 3300002504 | Unclassified | 702 |
| 172 | JGI24705J35276_11867620 | 3300002504 | Bacteria | 727 |
| 173 | JGI24705J35276_12132344 | 3300002504 | Bacteria | 1109 |
| 174 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 175 | JGI24696J40584_12654229 | 3300002834 | Bacteria | 696 |
| 176 | JGI24696J40584_12916606 | 3300002834 | Bacteria | 1304 |
| 177 | Ga0068305_10200441 | 3300005083 | Bacteria | 1096 |
| 178 | Ga0466734_038258 | 3300042623 | Bacteria | 1082 |
| 179 | Ga0466735_110439 | 3300042624 | Bacteria | 1803 |
| 180 | Ga0466730_081474 | 3300042625 | Bacteria | 2650 |
| 181 | Ga0466702_138136 | 3300042635 | Unclassified | 1906 |
| 182 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 183 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 184 | Ga0466709_124093 | 3300042648 | Bacteria | 6162 |
| 185 | Ga0466709_266727 | 3300042648 | Bacteria | 3133 |
| 186 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 187 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 188 | Ga0466710_319466 | 3300042613 | Bacteria | 1153 |
| 189 | Ga0466711_306949 | 3300042615 | Bacteria | 7933 |
| 190 | Ga0466715_209992 | 3300042616 | Bacteria | 7477 |
| 191 | Ga0466723_082479 | 3300042618 | Bacteria | 5238 |
| 192 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 193 | Ga0466726_069100 | 3300042619 | Bacteria | 5355 |
| 194 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 195 | Ga0466729_112686 | 3300042621 | Bacteria | 10506 |
| 196 | Ga0466697_171567 | 3300042611 | Bacteria | 2992 |
| 197 | Ga0466705_111418 | 3300042612 | Bacteria | 19183 |
| 198 | Ga0466732_322418 | 3300042656 | Unclassified | 2432 |
| 199 | Ga0466690_088011 | 3300042590 | Bacteria | 17371 |
| 200 | Ga0466696_235172 | 3300042596 | Bacteria | 1783 |
| 201 | Ga0123357_10234730 | 3300009784 | Bacteria | 2001 |
| 202 | Ga0123357_10360950 | 3300009784 | Bacteria | 1376 |
| 203 | Ga0123356_10370585 | 3300010049 | Bacteria | 1562 |
| 204 | Ga0123356_10384835 | 3300010049 | Unclassified | 1536 |
| 205 | Ga0123353_10398085 | 3300010167 | Bacteria | 2051 |
| 206 | Ga0466701_036012 | 3300042598 | Bacteria | 5947 |
| 207 | Ga0466701_038225 | 3300042598 | Bacteria | 12164 |
| 208 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 209 | Ga0466700_362329 | 3300042600 | Bacteria | 1992 |
| 210 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 211 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 212 | Ga0466713_035081 | 3300042602 | Bacteria | 6541 |
| 213 | Ga0466720_070035 | 3300042607 | Bacteria | 2421 |
| 214 | 2227160800 | 2225789004 | Bacteria | 1554 |
| 215 | 2227491320 | 2225789004 | Bacteria | 4075 |
| 216 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 217 | IMNBL1DRAFT_c0058981 | 3300000062 | Bacteria | 1163 |
| 218 | JGI24698J34947_10009875 | 3300002449 | Bacteria | 5232 |
| 219 | JGI24702J35022_10015605 | 3300002462 | Bacteria | 4175 |
| 220 | JGI24702J35022_10015899 | 3300002462 | Bacteria | 4132 |
| 221 | JGI24702J35022_10476861 | 3300002462 | Bacteria | 763 |
| 222 | JGI24702J35022_10483191 | 3300002462 | Bacteria | 758 |
| 223 | JGI24702J35022_10954954 | 3300002462 | Bacteria | 534 |
| 224 | JGI24705J35276_12230277 | 3300002504 | Bacteria | 3586 |
| 225 | Ga0068302_10021088 | 3300005071 | Bacteria | 2464 |
| 226 | Ga0068302_10124393 | 3300005071 | Bacteria | 5305 |
| 227 | Ga0466731_379372 | 3300042622 | Bacteria | 1136 |
| 228 | Ga0466734_046575 | 3300042623 | Bacteria | 1614 |
| 229 | Ga0466734_168927 | 3300042623 | Bacteria | 2289 |
| 230 | Ga0466735_140744 | 3300042624 | Unclassified | 1413 |
| 231 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 232 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 233 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 234 | Ga0466727_209714 | 3300042655 | Bacteria | 2537 |
| 235 | Ga0466710_282776 | 3300042613 | Bacteria | 1082 |
| 236 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 237 | Ga0466718_062717 | 3300042617 | Bacteria | 1007 |
| 238 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 239 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 240 | Ga0466690_170765 | 3300042590 | Bacteria | 1528 |
| 241 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 242 | Ga0123356_11959179 | 3300010049 | Bacteria | 730 |
| 243 | Ga0123353_11196884 | 3300010167 | Bacteria | 998 |
| 244 | Ga0123354_10006670 | 3300010882 | Bacteria | 17209 |
| 245 | Ga0123354_10030493 | 3300010882 | Bacteria | 8468 |
| 246 | Ga0466707_012616 | 3300042601 | Bacteria | 2473 |
| 247 | Ga0466707_021229 | 3300042601 | Bacteria | 1716 |
| 248 | Ga0466713_018853 | 3300042602 | Bacteria | 13634 |
| 249 | Ga0466713_090124 | 3300042602 | Bacteria | 2135 |
| 250 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 251 | Ga0466719_035836 | 3300042606 | Unclassified | 3324 |
| 252 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 253 | Ga0466719_381451 | 3300042606 | Bacteria | 3784 |
| 254 | Ga0466719_554685 | 3300042606 | Bacteria | 12056 |
| 255 | Ga0466720_119454 | 3300042607 | Bacteria | 1177 |
| 256 | Ga0466722_113610 | 3300042609 | Bacteria | 1793 |
| 257 | Ga0466697_018320 | 3300042611 | Bacteria | 1094 |
| 258 | JGI24705J35276_12237141 | 3300002504 | Bacteria | 9947 |
| 259 | Ga0068305_10043866 | 3300005083 | Bacteria | 3860 |
| 260 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 261 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 262 | Ga0466709_206429 | 3300042648 | Bacteria | 3179 |
| 263 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 264 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 265 | Ga0466727_331622 | 3300042655 | Bacteria | 5773 |
| 266 | Ga0466710_087835 | 3300042613 | Bacteria | 1266 |
| 267 | Ga0466712_311581 | 3300042614 | Bacteria | 1439 |
| 268 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 269 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00831 | Ribosomal_L29 | Ribosomal L29 protein | 4 | 59 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.