Protein Family IF00795
Metagenome
Isolate
229
Members
58
Samples
223
Scaffolds
159.93
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10018668|JGI24702J35022_100186682
- Length
- 175 aa
- Sequence
- MKYPDDFSRDSLAAAKRKLVRCKINGRDTETVVDIRASLTDMLRNEYSLTSVKKGCEVGECGACNVIINGECFNSCIYLAVWADGKEITTTEGLISADGELSSVQQAFIDEGAVQCGFCTPGFLVSAHEIIKSGKEYSDEELRVQLSGHLCRCTGYENIFKAVRKLTAAKNSKE*
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.6%
Kalotermitidae
24.1%
Unclassified
15.5%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 55 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_002692 | 3300042612 | Bacteria | 5419 |
| 2 | Ga0466705_166535 | 3300042612 | Bacteria | 2405 |
| 3 | Ga0466707_289773 | 3300042601 | Bacteria | 1712 |
| 4 | Ga0466717_123961 | 3300042604 | Bacteria | 1033 |
| 5 | Ga0466717_146045 | 3300042604 | Bacteria | 1294 |
| 6 | Ga0466717_171233 | 3300042604 | Bacteria | 2231 |
| 7 | Ga0466720_001805 | 3300042607 | Bacteria | 1839 |
| 8 | Ga0466720_037118 | 3300042607 | Bacteria | 7874 |
| 9 | Ga0466720_063382 | 3300042607 | Unclassified | 5138 |
| 10 | JGI24698J34947_10000656 | 3300002449 | Bacteria | 16792 |
| 11 | JGI24698J34947_10001995 | 3300002449 | Bacteria | 10890 |
| 12 | JGI24696J40584_12868843 | 3300002834 | Bacteria | 1038 |
| 13 | Ga0074263_112574 | 3300005485 | Bacteria | 2534 |
| 14 | Ga0466690_220801 | 3300042590 | Bacteria | 1817 |
| 15 | Ga0466692_037333 | 3300042591 | Bacteria | 1009 |
| 16 | Ga0466692_149528 | 3300042591 | Bacteria | 25005 |
| 17 | Ga0466694_040188 | 3300042594 | Bacteria | 2026 |
| 18 | Ga0466711_147446 | 3300042615 | Bacteria | 4038 |
| 19 | Ga0466723_015692 | 3300042618 | Bacteria | 5665 |
| 20 | Ga0123353_10094652 | 3300010167 | Bacteria | 4813 |
| 21 | Ga0123353_10215066 | 3300010167 | Bacteria | 3011 |
| 22 | Ga0123354_10209352 | 3300010882 | Bacteria | 2113 |
| 23 | Ga0466731_179384 | 3300042622 | Bacteria | 2935 |
| 24 | Ga0466735_030653 | 3300042624 | Unclassified | 3141 |
| 25 | Ga0466735_204630 | 3300042624 | Bacteria | 1020 |
| 26 | Ga0466732_120084 | 3300042656 | Bacteria | 3253 |
| 27 | Ga0466732_206748 | 3300042656 | Bacteria | 33874 |
| 28 | Ga0466701_028506 | 3300042598 | Bacteria | 3394 |
| 29 | Ga0466707_166157 | 3300042601 | Bacteria | 2394 |
| 30 | Ga0466719_047578 | 3300042606 | Bacteria | 2344 |
| 31 | Ga0466719_406811 | 3300042606 | Bacteria | 2843 |
| 32 | Ga0466720_074970 | 3300042607 | Bacteria | 4393 |
| 33 | AustNasuHG_c1006423 | 3300000089 | Bacteria | 4195 |
| 34 | JGI24698J34947_10006067 | 3300002449 | Bacteria | 6633 |
| 35 | JGI24698J34947_10018870 | 3300002449 | Bacteria | 3723 |
| 36 | JGI24698J34947_10028301 | 3300002449 | Bacteria | 2968 |
| 37 | JGI24702J35022_10018668 | 3300002462 | Bacteria | 3779 |
| 38 | JGI24702J35022_10213618 | 3300002462 | Bacteria | 1109 |
| 39 | JGI24705J35276_12238704 | 3300002504 | Bacteria | 40016 |
| 40 | Ga0072940_1150952 | 3300005200 | Bacteria | 2662 |
| 41 | Ga0074263_113729 | 3300005485 | Bacteria | 1405 |
| 42 | Ga0074263_115651 | 3300005485 | Unclassified | 2264 |
| 43 | Ga0466694_398354 | 3300042594 | Bacteria | 3183 |
| 44 | Ga0466696_233847 | 3300042596 | Bacteria | 11876 |
| 45 | Ga0466699_181164 | 3300042597 | Bacteria | 8990 |
| 46 | Ga0466712_244031 | 3300042614 | Bacteria | 3910 |
| 47 | Ga0466715_031092 | 3300042616 | Bacteria | 18789 |
| 48 | Ga0466718_002600 | 3300042617 | Bacteria | 7539 |
| 49 | Ga0466718_144496 | 3300042617 | Bacteria | 2135 |
| 50 | Ga0466723_196748 | 3300042618 | Bacteria | 8062 |
| 51 | Ga0466728_137543 | 3300042620 | Bacteria | 7941 |
| 52 | Ga0123355_10776740 | 3300009826 | Bacteria | 1075 |
| 53 | Ga0123353_10097745 | 3300010167 | Bacteria | 4732 |
| 54 | Ga0123354_10104082 | 3300010882 | Bacteria | 3811 |
| 55 | Ga0123354_10224484 | 3300010882 | Bacteria | 1984 |
| 56 | Ga0466735_186691 | 3300042624 | Bacteria | 9243 |
| 57 | Ga0466703_057057 | 3300042636 | Bacteria | 18027 |
| 58 | Ga0466705_012251 | 3300042612 | Bacteria | 4686 |
| 59 | Ga0466732_028632 | 3300042656 | Bacteria | 1564 |
| 60 | Ga0466732_171380 | 3300042656 | Unclassified | 8607 |
| 61 | Ga0466706_025839 | 3300042599 | Bacteria | 1236 |
| 62 | Ga0466706_106148 | 3300042599 | Bacteria | 1599 |
| 63 | Ga0466700_374482 | 3300042600 | Bacteria | 1321 |
| 64 | Ga0466713_061083 | 3300042602 | Bacteria | 1127 |
| 65 | Ga0466716_493108 | 3300042605 | Bacteria | 1360 |
| 66 | Ga0466720_116032 | 3300042607 | Bacteria | 2590 |
| 67 | Ga0466720_136018 | 3300042607 | Unclassified | 3514 |
| 68 | AustNasuHG_c1001405 | 3300000089 | Bacteria | 8616 |
| 69 | JGI24702J35022_10006645 | 3300002462 | Bacteria | 6675 |
| 70 | JGI24702J35022_10025387 | 3300002462 | Bacteria | 3198 |
| 71 | Ga0074263_100204 | 3300005485 | Bacteria | 1886 |
| 72 | Ga0074263_110220 | 3300005485 | Unclassified | 3277 |
| 73 | Ga0456237_0001075 | 3300041968 | Bacteria | 4319 |
| 74 | Ga0466691_041566 | 3300042593 | Bacteria | 5101 |
| 75 | Ga0466696_331947 | 3300042596 | Bacteria | 2100 |
| 76 | Ga0466712_285876 | 3300042614 | Bacteria | 7090 |
| 77 | Ga0466718_125888 | 3300042617 | Bacteria | 1610 |
| 78 | Ga0466726_466245 | 3300042619 | Bacteria | 6139 |
| 79 | Ga0123356_10413133 | 3300010049 | Unclassified | 1490 |
| 80 | Ga0466729_281880 | 3300042621 | Bacteria | 2567 |
| 81 | Ga0466703_089065 | 3300042636 | Bacteria | 4497 |
| 82 | Ga0466703_197852 | 3300042636 | Bacteria | 1671 |
| 83 | Ga0466703_275607 | 3300042636 | Bacteria | 1319 |
| 84 | Ga0466704_072846 | 3300042643 | Bacteria | 9739 |
| 85 | Ga0466709_388786 | 3300042648 | Bacteria | 6491 |
| 86 | Ga0466727_025567 | 3300042655 | Bacteria | 1874 |
| 87 | Ga0466732_116987 | 3300042656 | Bacteria | 10614 |
| 88 | Ga0466700_456042 | 3300042600 | Bacteria | 2697 |
| 89 | Ga0466717_313907 | 3300042604 | Bacteria | 1128 |
| 90 | Ga0466716_095669 | 3300042605 | Bacteria | 16417 |
| 91 | Ga0466720_156230 | 3300042607 | Bacteria | 6862 |
| 92 | Ga0466722_008840 | 3300042609 | Bacteria | 1492 |
| 93 | JGI24698J34947_10005089 | 3300002449 | Bacteria | 7202 |
| 94 | JGI24702J35022_10000856 | 3300002462 | Bacteria | 18817 |
| 95 | JGI24702J35022_10542374 | 3300002462 | Bacteria | 716 |
| 96 | JGI24705J35276_11938811 | 3300002504 | Bacteria | 784 |
| 97 | Ga0466690_409660 | 3300042590 | Bacteria | 1702 |
| 98 | Ga0466696_161458 | 3300042596 | Bacteria | 3131 |
| 99 | Ga0466712_215932 | 3300042614 | Bacteria | 17601 |
| 100 | Ga0466711_304391 | 3300042615 | Bacteria | 19363 |
| 101 | Ga0466715_266135 | 3300042616 | Bacteria | 4893 |
| 102 | Ga0466715_271874 | 3300042616 | Bacteria | 9236 |
| 103 | Ga0466718_166301 | 3300042617 | Bacteria | 2288 |
| 104 | Ga0466723_068990 | 3300042618 | Bacteria | 8193 |
| 105 | Ga0466723_169241 | 3300042618 | Bacteria | 1227 |
| 106 | Ga0466723_179504 | 3300042618 | Bacteria | 2783 |
| 107 | Ga0466726_192802 | 3300042619 | Bacteria | 3709 |
| 108 | Ga0466726_367912 | 3300042619 | Bacteria | 1636 |
| 109 | Ga0123356_10616370 | 3300010049 | Bacteria | 1251 |
| 110 | Ga0123353_12118761 | 3300010167 | Bacteria | 684 |
| 111 | Ga0466735_033234 | 3300042624 | Bacteria | 1048 |
| 112 | Ga0466704_556597 | 3300042643 | Bacteria | 4786 |
| 113 | Ga0466700_003824 | 3300042600 | Bacteria | 3946 |
| 114 | Ga0466700_219635 | 3300042600 | Bacteria | 2010 |
| 115 | Ga0466719_030345 | 3300042606 | Bacteria | 2033 |
| 116 | Ga0466722_256973 | 3300042609 | Bacteria | 13522 |
| 117 | AustNasuHG_c1020953 | 3300000089 | Bacteria | 2121 |
| 118 | JGI24705J35276_12113102 | 3300002504 | Bacteria | 1049 |
| 119 | Ga0074263_109011 | 3300005485 | Unclassified | 1527 |
| 120 | Ga0466690_008601 | 3300042590 | Bacteria | 1166 |
| 121 | Ga0466691_206564 | 3300042593 | Bacteria | 3122 |
| 122 | Ga0466694_153270 | 3300042594 | Bacteria | 5217 |
| 123 | Ga0466694_190389 | 3300042594 | Bacteria | 3199 |
| 124 | Ga0466699_117723 | 3300042597 | Bacteria | 20060 |
| 125 | Ga0466712_228610 | 3300042614 | Bacteria | 3351 |
| 126 | Ga0466715_272229 | 3300042616 | Bacteria | 6213 |
| 127 | Ga0466718_061007 | 3300042617 | Unclassified | 8057 |
| 128 | Ga0466726_315740 | 3300042619 | Bacteria | 1067 |
| 129 | Ga0123353_10060818 | 3300010167 | Bacteria | 6056 |
| 130 | Ga0123353_10445638 | 3300010167 | Bacteria | 1908 |
| 131 | Ga0123353_11339851 | 3300010167 | Bacteria | 926 |
| 132 | Ga0123354_10186757 | 3300010882 | Bacteria | 2341 |
| 133 | Ga0466729_307978 | 3300042621 | Bacteria | 1060 |
| 134 | Ga0466702_127854 | 3300042635 | Bacteria | 2226 |
| 135 | Ga0466704_127837 | 3300042643 | Bacteria | 6059 |
| 136 | Ga0466704_497686 | 3300042643 | Bacteria | 48350 |
| 137 | Ga0466709_090056 | 3300042648 | Bacteria | 7774 |
| 138 | Ga0466709_105237 | 3300042648 | Bacteria | 4523 |
| 139 | Ga0466709_142541 | 3300042648 | Bacteria | 4119 |
| 140 | Ga0466709_232081 | 3300042648 | Bacteria | 5703 |
| 141 | Ga0466705_066972 | 3300042612 | Unclassified | 13218 |
| 142 | Ga0466705_155051 | 3300042612 | Bacteria | 1007 |
| 143 | Ga0466732_265459 | 3300042656 | Unclassified | 1275 |
| 144 | Ga0466713_144727 | 3300042602 | Bacteria | 4699 |
| 145 | Ga0466717_072821 | 3300042604 | Bacteria | 1351 |
| 146 | Ga0466719_034776 | 3300042606 | Bacteria | 2176 |
| 147 | Ga0466720_115668 | 3300042607 | Bacteria | 34414 |
| 148 | Ga0466720_116391 | 3300042607 | Unclassified | 10145 |
| 149 | Ga0466720_200654 | 3300042607 | Bacteria | 1047 |
| 150 | Ga0466722_244021 | 3300042609 | Bacteria | 5634 |
| 151 | Ga0466698_215521 | 3300042610 | Bacteria | 2357 |
| 152 | AustNasuHG_c1029658 | 3300000089 | Bacteria | 1596 |
| 153 | Ga0466692_009455 | 3300042591 | Bacteria | 5843 |
| 154 | Ga0466694_035315 | 3300042594 | Bacteria | 3904 |
| 155 | Ga0466711_138716 | 3300042615 | Bacteria | 35012 |
| 156 | Ga0466711_403034 | 3300042615 | Bacteria | 3369 |
| 157 | Ga0466718_069494 | 3300042617 | Bacteria | 4923 |
| 158 | Ga0466723_049723 | 3300042618 | Bacteria | 2039 |
| 159 | Ga0466726_079328 | 3300042619 | Unclassified | 1276 |
| 160 | Ga0123356_10060157 | 3300010049 | Bacteria | 3545 |
| 161 | Ga0123353_10144268 | 3300010167 | Unclassified | 3809 |
| 162 | Ga0123353_10939943 | 3300010167 | Bacteria | 1171 |
| 163 | Ga0466708_119795 | 3300042652 | Bacteria | 18227 |
| 164 | Ga0466708_349043 | 3300042652 | Bacteria | 2784 |
| 165 | Ga0466706_278884 | 3300042599 | Bacteria | 2872 |
| 166 | Ga0466719_136477 | 3300042606 | Bacteria | 1245 |
| 167 | Ga0466719_553279 | 3300042606 | Bacteria | 3386 |
| 168 | Ga0466720_038702 | 3300042607 | Bacteria | 6567 |
| 169 | Ga0466720_067646 | 3300042607 | Unclassified | 6076 |
| 170 | Ga0466720_093870 | 3300042607 | Bacteria | 14876 |
| 171 | Ga0466722_021126 | 3300042609 | Bacteria | 7614 |
| 172 | Ga0466722_118719 | 3300042609 | Bacteria | 2854 |
| 173 | Ga0466722_218056 | 3300042609 | Bacteria | 3052 |
| 174 | Ga0415639_115136 | 3300038395 | Bacteria | 1215 |
| 175 | Ga0466691_037235 | 3300042593 | Bacteria | 18285 |
| 176 | Ga0466694_285000 | 3300042594 | Bacteria | 1840 |
| 177 | Ga0466695_406129 | 3300042595 | Bacteria | 3581 |
| 178 | Ga0466696_164536 | 3300042596 | Bacteria | 13837 |
| 179 | Ga0466712_183925 | 3300042614 | Bacteria | 19044 |
| 180 | Ga0466712_262020 | 3300042614 | Bacteria | 10459 |
| 181 | Ga0466723_164608 | 3300042618 | Bacteria | 7816 |
| 182 | Ga0466723_233690 | 3300042618 | Bacteria | 2265 |
| 183 | Ga0466726_122877 | 3300042619 | Bacteria | 1123 |
| 184 | Ga0466726_272314 | 3300042619 | Bacteria | 1192 |
| 185 | Ga0123353_10472939 | 3300010167 | Bacteria | 1837 |
| 186 | Ga0123353_10770772 | 3300010167 | Bacteria | 1335 |
| 187 | Ga0123354_10146219 | 3300010882 | Bacteria | 2892 |
| 188 | Ga0123354_10244053 | 3300010882 | Bacteria | 1839 |
| 189 | Ga0466735_201313 | 3300042624 | Bacteria | 5062 |
| 190 | Ga0466703_053761 | 3300042636 | Bacteria | 12401 |
| 191 | Ga0466709_324230 | 3300042648 | Bacteria | 7552 |
| 192 | Ga0466727_182414 | 3300042655 | Bacteria | 2441 |
| 193 | Ga0466727_337237 | 3300042655 | Bacteria | 1564 |
| 194 | Ga0466706_270557 | 3300042599 | Bacteria | 1700 |
| 195 | Ga0466719_110807 | 3300042606 | Bacteria | 31505 |
| 196 | Ga0466720_046137 | 3300042607 | Bacteria | 34047 |
| 197 | Ga0466720_085529 | 3300042607 | Unclassified | 2258 |
| 198 | Ga0466698_456495 | 3300042610 | Bacteria | 2438 |
| 199 | JGI24698J34947_10000031 | 3300002449 | Bacteria | 38432 |
| 200 | JGI24700J35501_10930615 | 3300002508 | Bacteria | 16789 |
| 201 | JGI24696J40584_12909959 | 3300002834 | Bacteria | 1247 |
| 202 | Ga0068305_10860536 | 3300005083 | Bacteria | 1721 |
| 203 | Ga0074263_100205 | 3300005485 | Bacteria | 4833 |
| 204 | Ga0466692_182672 | 3300042591 | Bacteria | 2553 |
| 205 | Ga0466691_100905 | 3300042593 | Bacteria | 10387 |
| 206 | Ga0466694_279467 | 3300042594 | Bacteria | 1573 |
| 207 | Ga0466696_230557 | 3300042596 | Bacteria | 4794 |
| 208 | Ga0466699_376040 | 3300042597 | Bacteria | 7558 |
| 209 | Ga0466712_233702 | 3300042614 | Unclassified | 2597 |
| 210 | Ga0466712_306692 | 3300042614 | Unclassified | 14047 |
| 211 | Ga0466711_012799 | 3300042615 | Bacteria | 2841 |
| 212 | Ga0466711_252206 | 3300042615 | Bacteria | 4007 |
| 213 | Ga0466715_302134 | 3300042616 | Unclassified | 2268 |
| 214 | Ga0466715_355320 | 3300042616 | Bacteria | 14755 |
| 215 | Ga0466715_395115 | 3300042616 | Bacteria | 3962 |
| 216 | Ga0466718_003092 | 3300042617 | Unclassified | 3044 |
| 217 | Ga0466723_048794 | 3300042618 | Bacteria | 3077 |
| 218 | Ga0466726_362270 | 3300042619 | Bacteria | 2503 |
| 219 | Ga0466726_459526 | 3300042619 | Bacteria | 10608 |
| 220 | Ga0466728_258466 | 3300042620 | Bacteria | 7285 |
| 221 | Ga0123357_10156552 | 3300009784 | Unclassified | 2746 |
| 222 | Ga0123353_10928357 | 3300010167 | Bacteria | 1181 |
| 223 | Ga0123354_10652801 | 3300010882 | Bacteria | 751 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01799 | Fer2_2 | [2Fe-2S] binding domain | 90 | 164 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.