Protein Family IF00790
Metagenome
Isolate
272
Members
88
Samples
231
Scaffolds
307.76
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10016798|JGI24702J35022_100167983
- Length
- 351 aa
- Sequence
- VVPQTTKIIGAKFSPLFDKPCKLMYNNYLYKFINSKENTMPLVTTKEMLAAAYEGGYAVGAFNVNNMEIIQGITQAGQKLNAPLILQVSKGARAYANHAYLVKLVEAALETTGLPIALHLDHGPDFDTCKSCIDGGFSSVMIDGSHHPYEENVAETRRVVEYAHARGVTVEGELGQLAGVEDDVNVSAEDASYTKPEQVEDFVTRTGVDSLAIAIGTSHGAFKFKPGTKPQLRFDILEEVARRLPGFPIVLHGASSVPQEFVAEINRYGGAMDDAIGIPEDMLRQAARMAVCKINIDSDLRLAMTAALRKHLAENPGHFDPRQYLSPARAAIQAMVEHKIENVLGCKGKA*
Sample Types
Isolate
15.1%
Metagenome
84.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.0%
Termitidae
23.9%
Kalotermitidae
17.0%
Blattidae
15.9%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Passalidae
2.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
245
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 4 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 5 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 6 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 7 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 18 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 19 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 20 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 21 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 33 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 34 | 2820467504 | Unclassified Firmicutes Lab288P3bin1 | Isolate | Unclassified |
| 35 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 48 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 49 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 50 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 53 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 54 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 55 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 56 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 57 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 58 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 64 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 65 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 66 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 67 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 68 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 71 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 72 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 73 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 74 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 75 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 82 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 83 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 87 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 88 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_308152 | 3300042612 | Bacteria | 62248 |
| 2 | Ga0123353_10002204 | 3300010167 | Bacteria | 24108 |
| 3 | Ga0123353_10088640 | 3300010167 | Bacteria | 4983 |
| 4 | Ga0466715_368032 | 3300042616 | Bacteria | 3412 |
| 5 | Ga0466726_059607 | 3300042619 | Bacteria | 7074 |
| 6 | Ga0466728_213063 | 3300042620 | Bacteria | 1634 |
| 7 | Ga0466703_336826 | 3300042636 | Unclassified | 2729 |
| 8 | Ga0466704_107429 | 3300042643 | Bacteria | 10766 |
| 9 | Ga0466704_243986 | 3300042643 | Bacteria | 2419 |
| 10 | Ga0466704_307663 | 3300042643 | Bacteria | 23999 |
| 11 | Ga0466727_212267 | 3300042655 | Bacteria | 1720 |
| 12 | Ga0466727_328135 | 3300042655 | Bacteria | 22306 |
| 13 | Ga0415639_001927 | 3300038395 | Bacteria | 50543 |
| 14 | Ga0415639_004820 | 3300038395 | Bacteria | 24670 |
| 15 | Ga0466692_008176 | 3300042591 | Bacteria | 16983 |
| 16 | Ga0466691_058202 | 3300042593 | Bacteria | 5290 |
| 17 | Ga0466701_032001 | 3300042598 | Bacteria | 5337 |
| 18 | Ga0466707_010622 | 3300042601 | Bacteria | 2035 |
| 19 | Ga0466707_140602 | 3300042601 | Bacteria | 3962 |
| 20 | Ga0466707_207876 | 3300042601 | Unclassified | 2059 |
| 21 | Ga0466713_129417 | 3300042602 | Bacteria | 66756 |
| 22 | Ga0466721_338740 | 3300042608 | Unclassified | 1377 |
| 23 | Ga0466705_141644 | 3300042612 | Bacteria | 18872 |
| 24 | Ga0123355_10392380 | 3300009826 | Bacteria | 1798 |
| 25 | Ga0123356_10008371 | 3300010049 | Bacteria | 10283 |
| 26 | Ga0123356_10010745 | 3300010049 | Bacteria | 8963 |
| 27 | Ga0123356_10018442 | 3300010049 | Bacteria | 6625 |
| 28 | Ga0123356_10830393 | 3300010049 | Bacteria | 1095 |
| 29 | Ga0123353_10005611 | 3300010167 | Bacteria | 16513 |
| 30 | Ga0123353_10084292 | 3300010167 | Bacteria | 5116 |
| 31 | Ga0123353_10256420 | 3300010167 | Bacteria | 2705 |
| 32 | Ga0123353_10469593 | 3300010167 | Bacteria | 1845 |
| 33 | Ga0466726_269220 | 3300042619 | Bacteria | 9599 |
| 34 | Ga0466728_368745 | 3300042620 | Unclassified | 2905 |
| 35 | Ga0466703_422634 | 3300042636 | Bacteria | 4788 |
| 36 | Ga0466704_095421 | 3300042643 | Bacteria | 4023 |
| 37 | Ga0466704_178396 | 3300042643 | Bacteria | 8769 |
| 38 | Ga0466708_321961 | 3300042652 | Bacteria | 10654 |
| 39 | Ga0466727_232644 | 3300042655 | Unclassified | 3186 |
| 40 | Ga0415639_032803 | 3300038395 | Bacteria | 8575 |
| 41 | Ga0466692_183036 | 3300042591 | Unclassified | 3991 |
| 42 | Ga0466691_219277 | 3300042593 | Unclassified | 7349 |
| 43 | Ga0466696_352812 | 3300042596 | Bacteria | 14703 |
| 44 | Ga0466696_478070 | 3300042596 | Bacteria | 7532 |
| 45 | 2227283565 | 2225789004 | Bacteria | 6800 |
| 46 | IMNBL1DRAFT_c0004281 | 3300000062 | Bacteria | 8631 |
| 47 | Ga0466706_167063 | 3300042599 | Bacteria | 2121 |
| 48 | Ga0466707_081341 | 3300042601 | Bacteria | 5327 |
| 49 | Ga0466707_145331 | 3300042601 | Bacteria | 12330 |
| 50 | Ga0466707_181727 | 3300042601 | Bacteria | 103366 |
| 51 | Ga0466707_270274 | 3300042601 | Bacteria | 5674 |
| 52 | Ga0466714_019004 | 3300042603 | Bacteria | 23621 |
| 53 | Ga0466722_197617 | 3300042609 | Bacteria | 2382 |
| 54 | Ga0466705_107110 | 3300042612 | Bacteria | 10541 |
| 55 | Ga0466705_182360 | 3300042612 | Bacteria | 2791 |
| 56 | Ga0466705_354482 | 3300042612 | Unclassified | 1961 |
| 57 | Ga0466733_085024 | 3300042659 | Bacteria | 2071 |
| 58 | Ga0466733_119550 | 3300042659 | Bacteria | 1070 |
| 59 | Ga0123355_10067410 | 3300009826 | Unclassified | 5759 |
| 60 | Ga0123355_10161033 | 3300009826 | Bacteria | 3381 |
| 61 | Ga0123355_10262394 | 3300009826 | Bacteria | 2414 |
| 62 | Ga0123356_10016024 | 3300010049 | Bacteria | 7165 |
| 63 | Ga0123356_10054790 | 3300010049 | Bacteria | 3714 |
| 64 | Ga0123356_10340903 | 3300010049 | Bacteria | 1619 |
| 65 | Ga0123356_10467381 | 3300010049 | Bacteria | 1412 |
| 66 | Ga0123353_10002465 | 3300010167 | Bacteria | 23020 |
| 67 | Ga0123353_10032320 | 3300010167 | Bacteria | 8125 |
| 68 | Ga0123353_10592334 | 3300010167 | Bacteria | 1587 |
| 69 | Ga0466710_211301 | 3300042613 | Bacteria | 1200 |
| 70 | Ga0466711_233268 | 3300042615 | Unclassified | 2248 |
| 71 | Ga0466711_399432 | 3300042615 | Bacteria | 9587 |
| 72 | Ga0466715_075038 | 3300042616 | Bacteria | 1762 |
| 73 | Ga0466715_291194 | 3300042616 | Bacteria | 10582 |
| 74 | Ga0466718_054429 | 3300042617 | Bacteria | 10976 |
| 75 | Ga0466718_162793 | 3300042617 | Bacteria | 1243 |
| 76 | Ga0466718_167905 | 3300042617 | Unclassified | 3917 |
| 77 | Ga0466723_063667 | 3300042618 | Unclassified | 3816 |
| 78 | Ga0466723_200063 | 3300042618 | Bacteria | 4354 |
| 79 | Ga0466726_366879 | 3300042619 | Unclassified | 1789 |
| 80 | Ga0466726_375141 | 3300042619 | Bacteria | 1621 |
| 81 | Ga0466726_489376 | 3300042619 | Bacteria | 2232 |
| 82 | Ga0466729_135553 | 3300042621 | Bacteria | 2874 |
| 83 | Ga0466729_149349 | 3300042621 | Bacteria | 12307 |
| 84 | Ga0466704_468556 | 3300042643 | Bacteria | 6698 |
| 85 | Ga0466708_137687 | 3300042652 | Bacteria | 18410 |
| 86 | Ga0415639_008875 | 3300038395 | Bacteria | 38287 |
| 87 | Ga0415639_069742 | 3300038395 | Unclassified | 2713 |
| 88 | Ga0466696_292456 | 3300042596 | Unclassified | 3761 |
| 89 | JGI24702J35022_10016798 | 3300002462 | Bacteria | 4008 |
| 90 | Ga0466706_126014 | 3300042599 | Bacteria | 2021 |
| 91 | Ga0466707_142854 | 3300042601 | Bacteria | 11637 |
| 92 | Ga0466707_281204 | 3300042601 | Bacteria | 4359 |
| 93 | Ga0466707_358668 | 3300042601 | Bacteria | 10235 |
| 94 | Ga0466719_126515 | 3300042606 | Bacteria | 1353 |
| 95 | Ga0466719_477443 | 3300042606 | Bacteria | 28839 |
| 96 | Ga0123356_10012907 | 3300010049 | Bacteria | 8088 |
| 97 | Ga0123356_10013016 | 3300010049 | Bacteria | 8048 |
| 98 | Ga0123356_10144466 | 3300010049 | Bacteria | 2352 |
| 99 | Ga0123356_10233885 | 3300010049 | Bacteria | 1904 |
| 100 | Ga0123353_10126770 | 3300010167 | Bacteria | 4102 |
| 101 | Ga0123354_10023655 | 3300010882 | Bacteria | 9689 |
| 102 | Ga0466715_646437 | 3300042616 | Bacteria | 7627 |
| 103 | Ga0466735_002738 | 3300042624 | Bacteria | 1310 |
| 104 | Ga0466708_092282 | 3300042652 | Bacteria | 46348 |
| 105 | Ga0466727_044104 | 3300042655 | Bacteria | 9751 |
| 106 | Ga0466692_004119 | 3300042591 | Bacteria | 15497 |
| 107 | Ga0466696_192682 | 3300042596 | Bacteria | 3729 |
| 108 | IMNBL1DRAFT_c0007478 | 3300000062 | Bacteria | 5741 |
| 109 | Ga0466707_195744 | 3300042601 | Bacteria | 1095 |
| 110 | Ga0466707_401869 | 3300042601 | Bacteria | 17023 |
| 111 | Ga0466713_045730 | 3300042602 | Bacteria | 108789 |
| 112 | Ga0466714_057517 | 3300042603 | Bacteria | 2544 |
| 113 | Ga0466716_285063 | 3300042605 | Bacteria | 2200 |
| 114 | Ga0466722_122996 | 3300042609 | Bacteria | 37046 |
| 115 | Ga0466722_222865 | 3300042609 | Bacteria | 5797 |
| 116 | Ga0466705_001415 | 3300042612 | Unclassified | 2252 |
| 117 | Ga0466705_045329 | 3300042612 | Bacteria | 5320 |
| 118 | Ga0466705_342116 | 3300042612 | Bacteria | 1332 |
| 119 | Ga0466733_009857 | 3300042659 | Bacteria | 2691 |
| 120 | Ga0123355_10004045 | 3300009826 | Bacteria | 21255 |
| 121 | Ga0123356_10014294 | 3300010049 | Unclassified | 7637 |
| 122 | Ga0123353_10448219 | 3300010167 | Bacteria | 1901 |
| 123 | Ga0123353_10473689 | 3300010167 | Bacteria | 1834 |
| 124 | Ga0123354_10024504 | 3300010882 | Bacteria | 9520 |
| 125 | Ga0466711_395363 | 3300042615 | Unclassified | 3783 |
| 126 | Ga0466726_261800 | 3300042619 | Bacteria | 10854 |
| 127 | Ga0466703_040421 | 3300042636 | Bacteria | 11879 |
| 128 | Ga0466703_307482 | 3300042636 | Bacteria | 1057 |
| 129 | Ga0466704_553937 | 3300042643 | Bacteria | 6075 |
| 130 | Ga0466708_077145 | 3300042652 | Bacteria | 85692 |
| 131 | Ga0466693_066650 | 3300042592 | Bacteria | 1678 |
| 132 | Ga0068305_10024913 | 3300005083 | Bacteria | 64942 |
| 133 | Ga0466707_002829 | 3300042601 | Bacteria | 21778 |
| 134 | Ga0466707_040784 | 3300042601 | Bacteria | 59863 |
| 135 | Ga0466707_136639 | 3300042601 | Unclassified | 5589 |
| 136 | Ga0466707_204995 | 3300042601 | Bacteria | 14207 |
| 137 | Ga0466707_323179 | 3300042601 | Bacteria | 4377 |
| 138 | Ga0466714_039383 | 3300042603 | Bacteria | 12121 |
| 139 | Ga0466721_111469 | 3300042608 | Bacteria | 7274 |
| 140 | Ga0123357_10350072 | 3300009784 | Bacteria | 1415 |
| 141 | Ga0123355_10000916 | 3300009826 | Bacteria | 40844 |
| 142 | Ga0123356_10174156 | 3300010049 | Unclassified | 2166 |
| 143 | Ga0123353_10002982 | 3300010167 | Bacteria | 21189 |
| 144 | Ga0123353_10030908 | 3300010167 | Bacteria | 8284 |
| 145 | Ga0123353_10154350 | 3300010167 | Bacteria | 3662 |
| 146 | Ga0123353_10163646 | 3300010167 | Bacteria | 3539 |
| 147 | Ga0466715_589982 | 3300042616 | Bacteria | 2805 |
| 148 | Ga0466734_083997 | 3300042623 | Bacteria | 2929 |
| 149 | Ga0466702_126870 | 3300042635 | Bacteria | 1041 |
| 150 | Ga0466703_400383 | 3300042636 | Bacteria | 1575 |
| 151 | Ga0466704_304350 | 3300042643 | Bacteria | 51733 |
| 152 | Ga0466656_039249 | 3300042550 | Bacteria | 1301 |
| 153 | Ga0466692_039762 | 3300042591 | Bacteria | 97120 |
| 154 | Ga0466696_221560 | 3300042596 | Bacteria | 5338 |
| 155 | JGI24702J35022_10008458 | 3300002462 | Unclassified | 5823 |
| 156 | Ga0466706_062956 | 3300042599 | Bacteria | 63611 |
| 157 | Ga0466706_272378 | 3300042599 | Bacteria | 1188 |
| 158 | Ga0466707_050203 | 3300042601 | Bacteria | 4425 |
| 159 | Ga0466707_341223 | 3300042601 | Bacteria | 5563 |
| 160 | Ga0466713_010250 | 3300042602 | Bacteria | 3031 |
| 161 | Ga0466713_013162 | 3300042602 | Bacteria | 27722 |
| 162 | Ga0466714_109033 | 3300042603 | Bacteria | 1409 |
| 163 | Ga0466714_110041 | 3300042603 | Bacteria | 16503 |
| 164 | Ga0466714_169452 | 3300042603 | Bacteria | 3143 |
| 165 | Ga0466719_233762 | 3300042606 | Bacteria | 9801 |
| 166 | Ga0466721_082638 | 3300042608 | Bacteria | 41161 |
| 167 | Ga0466722_039316 | 3300042609 | Bacteria | 5915 |
| 168 | Ga0466722_230647 | 3300042609 | Bacteria | 3137 |
| 169 | Ga0123356_10020852 | 3300010049 | Bacteria | 6199 |
| 170 | Ga0123356_10157336 | 3300010049 | Bacteria | 2265 |
| 171 | Ga0123356_10339373 | 3300010049 | Bacteria | 1622 |
| 172 | Ga0123353_10004189 | 3300010167 | Bacteria | 18512 |
| 173 | Ga0123353_10018243 | 3300010167 | Bacteria | 10366 |
| 174 | Ga0123353_10089750 | 3300010167 | Bacteria | 4949 |
| 175 | Ga0123353_10133480 | 3300010167 | Bacteria | 3983 |
| 176 | Ga0466705_494069 | 3300042612 | Bacteria | 6385 |
| 177 | Ga0466715_029604 | 3300042616 | Bacteria | 97338 |
| 178 | Ga0466715_034925 | 3300042616 | Bacteria | 8870 |
| 179 | Ga0466715_199775 | 3300042616 | Bacteria | 3042 |
| 180 | Ga0466723_045533 | 3300042618 | Bacteria | 3957 |
| 181 | Ga0466723_078486 | 3300042618 | Bacteria | 8319 |
| 182 | Ga0466723_193848 | 3300042618 | Bacteria | 21073 |
| 183 | Ga0466729_194929 | 3300042621 | Bacteria | 12458 |
| 184 | Ga0466731_352571 | 3300042622 | Unclassified | 2314 |
| 185 | Ga0466702_147846 | 3300042635 | Unclassified | 1499 |
| 186 | Ga0466703_367353 | 3300042636 | Bacteria | 14222 |
| 187 | Ga0466704_048940 | 3300042643 | Bacteria | 13322 |
| 188 | Ga0466709_389910 | 3300042648 | Bacteria | 5086 |
| 189 | Ga0466709_410265 | 3300042648 | Bacteria | 1053 |
| 190 | Ga0466708_191573 | 3300042652 | Unclassified | 1390 |
| 191 | Ga0466727_135049 | 3300042655 | Bacteria | 7525 |
| 192 | Ga0415639_001926 | 3300038395 | Bacteria | 19116 |
| 193 | Ga0466696_341062 | 3300042596 | Bacteria | 3563 |
| 194 | Ga0466707_186706 | 3300042601 | Bacteria | 9712 |
| 195 | Ga0466714_092033 | 3300042603 | Bacteria | 1547 |
| 196 | Ga0466716_030825 | 3300042605 | Bacteria | 3779 |
| 197 | Ga0466719_041703 | 3300042606 | Bacteria | 18542 |
| 198 | Ga0466719_427303 | 3300042606 | Unclassified | 1086 |
| 199 | Ga0466697_010818 | 3300042611 | Bacteria | 4157 |
| 200 | Ga0466705_146571 | 3300042612 | Unclassified | 7719 |
| 201 | Ga0123357_10048804 | 3300009784 | Bacteria | 5736 |
| 202 | Ga0123356_10005926 | 3300010049 | Bacteria | 12402 |
| 203 | Ga0123353_10044157 | 3300010167 | Bacteria | 7064 |
| 204 | Ga0123353_10297937 | 3300010167 | Bacteria | 2464 |
| 205 | Ga0466705_493733 | 3300042612 | Bacteria | 32120 |
| 206 | Ga0466711_188899 | 3300042615 | Bacteria | 5578 |
| 207 | Ga0466715_283567 | 3300042616 | Bacteria | 38359 |
| 208 | Ga0466718_049454 | 3300042617 | Bacteria | 2361 |
| 209 | Ga0466726_241849 | 3300042619 | Bacteria | 22316 |
| 210 | Ga0466728_170031 | 3300042620 | Bacteria | 3055 |
| 211 | Ga0466728_400887 | 3300042620 | Bacteria | 7685 |
| 212 | Ga0466735_073564 | 3300042624 | Bacteria | 1830 |
| 213 | Ga0466735_106884 | 3300042624 | Bacteria | 1096 |
| 214 | Ga0466703_026096 | 3300042636 | Bacteria | 85498 |
| 215 | Ga0466704_220900 | 3300042643 | Bacteria | 15289 |
| 216 | Ga0466704_424784 | 3300042643 | Unclassified | 3671 |
| 217 | Ga0466704_427500 | 3300042643 | Bacteria | 3636 |
| 218 | Ga0466727_039034 | 3300042655 | Bacteria | 4730 |
| 219 | Ga0415639_010116 | 3300038395 | Bacteria | 41747 |
| 220 | Ga0466690_429187 | 3300042590 | Bacteria | 2019 |
| 221 | Ga0466696_193035 | 3300042596 | Bacteria | 1189 |
| 222 | Ga0466696_391892 | 3300042596 | Bacteria | 1290 |
| 223 | JGI24698J34947_10047588 | 3300002449 | Bacteria | 2176 |
| 224 | JGI24702J35022_10000888 | 3300002462 | Bacteria | 18542 |
| 225 | Ga0466706_219638 | 3300042599 | Bacteria | 29525 |
| 226 | Ga0466706_235582 | 3300042599 | Bacteria | 2227 |
| 227 | Ga0466700_343633 | 3300042600 | Bacteria | 1979 |
| 228 | Ga0466707_180176 | 3300042601 | Bacteria | 19494 |
| 229 | Ga0466707_205594 | 3300042601 | Bacteria | 1703 |
| 230 | Ga0466713_112217 | 3300042602 | Bacteria | 4156 |
| 231 | Ga0466719_314778 | 3300042606 | Bacteria | 6642 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01116 | F_bP_aldolase | Fructose-bisphosphate aldolase class-II | 43 | 349 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.