Protein Family IF00786
Metagenome
Metatranscriptome
Isolate
353
Members
68
Samples
332
Scaffolds
91.06
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10012448|JGI24702J35022_1001244810
- Length
- 110 aa
- Sequence
- MGCGAKPHVRAETMEVYGDMSRSVKKGPFAAPELLKRIDAMNASGEKKVLKTWSRASTIFPSFVGHTIAVHDGRRHIPVYITEDMVGHKLGEFAPTRTFRGHAGSKTSR*
Sample Types
Isolate
6.0%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.1%
Unclassified
33.8%
Kalotermitidae
10.3%
Termopsidae
5.9%
Passalidae
4.4%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
223
Eukaryota
0
Viruses
0
Unclassified
130
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 6 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 7 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 8 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 9 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 12 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 13 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 14 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 15 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 16 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 27 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 35 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 36 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 47 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 48 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 53 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 54 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 55 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 56 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 62 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 63 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_152973 | 3300042599 | Bacteria | 4033 |
| 2 | Ga0466707_401523 | 3300042601 | Bacteria | 35627 |
| 3 | Ga0466719_001351 | 3300042606 | Bacteria | 6216 |
| 4 | Ga0466721_266574 | 3300042608 | Bacteria | 1102 |
| 5 | Ga0466694_400020 | 3300042594 | Bacteria | 4013 |
| 6 | Ga0466702_014851 | 3300042635 | Bacteria | 1387 |
| 7 | Ga0466702_241227 | 3300042635 | Unclassified | 1074 |
| 8 | Ga0466725_138791 | 3300042654 | Bacteria | 4403 |
| 9 | 2227004815 | 2225789003 | Unclassified | 1248 |
| 10 | IMNBL1DRAFT_c0000333 | 3300000062 | Bacteria | 40018 |
| 11 | JGI24702J35022_10087626 | 3300002462 | Bacteria | 1691 |
| 12 | JGI24705J35276_12103649 | 3300002504 | Unclassified | 1024 |
| 13 | Ga0068305_10008099 | 3300005083 | Bacteria | 232741 |
| 14 | Ga0072940_1352887 | 3300005200 | Unclassified | 1569 |
| 15 | Ga0123355_10104606 | 3300009826 | Bacteria | 4445 |
| 16 | Ga0123355_10394588 | 3300009826 | Unclassified | 1791 |
| 17 | Ga0123355_10699039 | 3300009826 | Unclassified | 1165 |
| 18 | Ga0123355_10801035 | 3300009826 | Unclassified | 1050 |
| 19 | Ga0123355_11329611 | 3300009826 | Unclassified | 718 |
| 20 | Ga0123356_10211968 | 3300010049 | Bacteria | 1987 |
| 21 | Ga0123356_10227141 | 3300010049 | Unclassified | 1928 |
| 22 | Ga0123356_10396993 | 3300010049 | Unclassified | 1516 |
| 23 | Ga0123356_10400582 | 3300010049 | Unclassified | 1510 |
| 24 | Ga0123356_10630820 | 3300010049 | Bacteria | 1238 |
| 25 | Ga0123356_10937964 | 3300010049 | Unclassified | 1036 |
| 26 | Ga0123356_11117289 | 3300010049 | Unclassified | 956 |
| 27 | Ga0123356_11215491 | 3300010049 | Bacteria | 919 |
| 28 | Ga0123356_11216430 | 3300010049 | Bacteria | 919 |
| 29 | Ga0123356_11254501 | 3300010049 | Unclassified | 906 |
| 30 | Ga0123356_11684794 | 3300010049 | Unclassified | 786 |
| 31 | Ga0123356_12589719 | 3300010049 | Unclassified | 635 |
| 32 | Ga0123356_13189688 | 3300010049 | Unclassified | 571 |
| 33 | Ga0123356_13560011 | 3300010049 | Unclassified | 539 |
| 34 | Ga0123353_10113441 | 3300010167 | Bacteria | 4363 |
| 35 | Ga0123353_10115802 | 3300010167 | Bacteria | 4314 |
| 36 | Ga0123353_10258813 | 3300010167 | Bacteria | 2690 |
| 37 | Ga0123353_10447857 | 3300010167 | Unclassified | 1902 |
| 38 | Ga0123353_10510872 | 3300010167 | Bacteria | 1747 |
| 39 | Ga0123353_11178338 | 3300010167 | Unclassified | 1008 |
| 40 | Ga0123353_11283681 | 3300010167 | Bacteria | 952 |
| 41 | Ga0123353_11733086 | 3300010167 | Unclassified | 780 |
| 42 | Ga0123353_12175425 | 3300010167 | Bacteria | 672 |
| 43 | Ga0123353_13260810 | 3300010167 | Bacteria | 519 |
| 44 | Ga0466697_189533 | 3300042611 | Bacteria | 1218 |
| 45 | Ga0466707_113611 | 3300042601 | Bacteria | 15317 |
| 46 | Ga0466707_304242 | 3300042601 | Bacteria | 14355 |
| 47 | Ga0466707_318656 | 3300042601 | Bacteria | 1552 |
| 48 | Ga0466719_048766 | 3300042606 | Unclassified | 1352 |
| 49 | Ga0415639_002987 | 3300038395 | Bacteria | 1554 |
| 50 | Ga0466693_412410 | 3300042592 | Bacteria | 1139 |
| 51 | Ga0466731_012103 | 3300042622 | Bacteria | 2005 |
| 52 | Ga0466727_265871 | 3300042655 | Bacteria | 2967 |
| 53 | IMNBL1DRAFT_c0015662 | 3300000062 | Bacteria | 3282 |
| 54 | JGI24695J34938_10437360 | 3300002450 | Bacteria | 589 |
| 55 | JGI24702J35022_10012448 | 3300002462 | Bacteria | 4730 |
| 56 | JGI24705J35276_12032046 | 3300002504 | Bacteria | 890 |
| 57 | Ga0123355_10016864 | 3300009826 | Bacteria | 11523 |
| 58 | Ga0123355_10029095 | 3300009826 | Bacteria | 8938 |
| 59 | Ga0123355_10046003 | 3300009826 | Bacteria | 7098 |
| 60 | Ga0123355_10070276 | 3300009826 | Bacteria | 5624 |
| 61 | Ga0123355_10410552 | 3300009826 | Unclassified | 1739 |
| 62 | Ga0123355_10554103 | 3300009826 | Bacteria | 1388 |
| 63 | Ga0123355_10578879 | 3300009826 | Unclassified | 1343 |
| 64 | Ga0123355_10679429 | 3300009826 | Bacteria | 1190 |
| 65 | Ga0123355_11825304 | 3300009826 | Unclassified | 572 |
| 66 | Ga0123355_11914255 | 3300009826 | Unclassified | 554 |
| 67 | Ga0123356_10000163 | 3300010049 | Bacteria | 75104 |
| 68 | Ga0123356_10039834 | 3300010049 | Bacteria | 4377 |
| 69 | Ga0123356_10099121 | 3300010049 | Bacteria | 2792 |
| 70 | Ga0123356_10120217 | 3300010049 | Bacteria | 2553 |
| 71 | Ga0123356_10438512 | 3300010049 | Unclassified | 1452 |
| 72 | Ga0123356_10661837 | 3300010049 | Unclassified | 1212 |
| 73 | Ga0123356_10892676 | 3300010049 | Unclassified | 1060 |
| 74 | Ga0123356_11165870 | 3300010049 | Unclassified | 937 |
| 75 | Ga0123356_11314954 | 3300010049 | Bacteria | 886 |
| 76 | Ga0123356_11849784 | 3300010049 | Bacteria | 751 |
| 77 | Ga0123356_12324991 | 3300010049 | Unclassified | 670 |
| 78 | Ga0123353_10108567 | 3300010167 | Bacteria | 4472 |
| 79 | Ga0123353_10224154 | 3300010167 | Bacteria | 2937 |
| 80 | Ga0123353_10334869 | 3300010167 | Bacteria | 2289 |
| 81 | Ga0123353_10673652 | 3300010167 | Unclassified | 1458 |
| 82 | Ga0123353_11515258 | 3300010167 | Bacteria | 853 |
| 83 | Ga0123353_11947793 | 3300010167 | Bacteria | 722 |
| 84 | Ga0123353_13309875 | 3300010167 | Unclassified | 514 |
| 85 | Ga0123354_10047929 | 3300010882 | Bacteria | 6504 |
| 86 | Ga0123354_10172652 | 3300010882 | Bacteria | 2507 |
| 87 | Ga0123354_10500837 | 3300010882 | Unclassified | 947 |
| 88 | Ga0466697_134820 | 3300042611 | Bacteria | 2806 |
| 89 | Ga0466706_212420 | 3300042599 | Bacteria | 1000 |
| 90 | Ga0466707_242820 | 3300042601 | Bacteria | 2785 |
| 91 | Ga0466707_245366 | 3300042601 | Bacteria | 4654 |
| 92 | Ga0255786_1019373 | 3300022815 | Bacteria | 850 |
| 93 | Ga0466696_221565 | 3300042596 | Bacteria | 4406 |
| 94 | Ga0466709_346362 | 3300042648 | Bacteria | 31912 |
| 95 | Ga0466724_66611 | 3300042649 | Bacteria | 1109 |
| 96 | Ga0466727_121927 | 3300042655 | Unclassified | 1057 |
| 97 | 2227585012 | 2225789004 | Unclassified | 512 |
| 98 | IMNBL1DRAFT_c0001875 | 3300000062 | Bacteria | 15304 |
| 99 | JGI24695J34938_10000194 | 3300002450 | Bacteria | 56974 |
| 100 | JGI24695J34938_10461866 | 3300002450 | Unclassified | 575 |
| 101 | JGI24702J35022_10239869 | 3300002462 | Bacteria | 1051 |
| 102 | Ga0123355_10066039 | 3300009826 | Bacteria | 5825 |
| 103 | Ga0123355_10164465 | 3300009826 | Bacteria | 3333 |
| 104 | Ga0123355_10461198 | 3300009826 | Unclassified | 1594 |
| 105 | Ga0123355_10478369 | 3300009826 | Bacteria | 1551 |
| 106 | Ga0123356_10013957 | 3300010049 | Bacteria | 7729 |
| 107 | Ga0123356_10031491 | 3300010049 | Bacteria | 4963 |
| 108 | Ga0123356_10039659 | 3300010049 | Bacteria | 4387 |
| 109 | Ga0123356_10050997 | 3300010049 | Bacteria | 3849 |
| 110 | Ga0123356_10228137 | 3300010049 | Unclassified | 1924 |
| 111 | Ga0123356_10511781 | 3300010049 | Bacteria | 1358 |
| 112 | Ga0123356_11840310 | 3300010049 | Unclassified | 753 |
| 113 | Ga0123356_14064896 | 3300010049 | Bacteria | 503 |
| 114 | Ga0123353_10021904 | 3300010167 | Bacteria | 9608 |
| 115 | Ga0123353_10028919 | 3300010167 | Bacteria | 8529 |
| 116 | Ga0123353_10052085 | 3300010167 | Bacteria | 6535 |
| 117 | Ga0123353_10434907 | 3300010167 | Bacteria | 1938 |
| 118 | Ga0123353_10780654 | 3300010167 | Unclassified | 1323 |
| 119 | Ga0123353_10837674 | 3300010167 | Unclassified | 1263 |
| 120 | Ga0123353_10883430 | 3300010167 | Bacteria | 1220 |
| 121 | Ga0123353_10966428 | 3300010167 | Unclassified | 1150 |
| 122 | Ga0123353_10988192 | 3300010167 | Bacteria | 1133 |
| 123 | Ga0123353_10995630 | 3300010167 | Unclassified | 1127 |
| 124 | Ga0123353_11207549 | 3300010167 | Unclassified | 992 |
| 125 | Ga0123353_11369784 | 3300010167 | Unclassified | 912 |
| 126 | Ga0123353_12849155 | 3300010167 | Bacteria | 565 |
| 127 | Ga0466707_294631 | 3300042601 | Bacteria | 9159 |
| 128 | Ga0466714_036028 | 3300042603 | Bacteria | 2335 |
| 129 | Ga0466721_130275 | 3300042608 | Bacteria | 11584 |
| 130 | Ga0466693_038405 | 3300042592 | Unclassified | 1249 |
| 131 | Ga0466693_441077 | 3300042592 | Unclassified | 3041 |
| 132 | Ga0466734_058271 | 3300042623 | Bacteria | 1358 |
| 133 | Ga0466704_387670 | 3300042643 | Bacteria | 16309 |
| 134 | JGI24695J34938_10007536 | 3300002450 | Bacteria | 6352 |
| 135 | JGI24702J35022_10019835 | 3300002462 | Bacteria | 3657 |
| 136 | Ga0068302_10230858 | 3300005071 | Unclassified | 1115 |
| 137 | Ga0123355_10099068 | 3300009826 | Bacteria | 4594 |
| 138 | Ga0123355_10175361 | 3300009826 | Bacteria | 3194 |
| 139 | Ga0123355_10599677 | 3300009826 | Unclassified | 1308 |
| 140 | Ga0123355_10795771 | 3300009826 | Unclassified | 1056 |
| 141 | Ga0123355_11018989 | 3300009826 | Unclassified | 876 |
| 142 | Ga0123356_10001870 | 3300010049 | Bacteria | 22811 |
| 143 | Ga0123356_10004438 | 3300010049 | Bacteria | 14509 |
| 144 | Ga0123356_10639979 | 3300010049 | Unclassified | 1230 |
| 145 | Ga0123356_11162014 | 3300010049 | Unclassified | 939 |
| 146 | Ga0123356_11261864 | 3300010049 | Bacteria | 903 |
| 147 | Ga0123356_11868564 | 3300010049 | Bacteria | 747 |
| 148 | Ga0123356_13372581 | 3300010049 | Unclassified | 555 |
| 149 | Ga0123356_14052918 | 3300010049 | Bacteria | 504 |
| 150 | Ga0123353_10003404 | 3300010167 | Bacteria | 20101 |
| 151 | Ga0123353_10534846 | 3300010167 | Unclassified | 1696 |
| 152 | Ga0123353_10537964 | 3300010167 | Bacteria | 1689 |
| 153 | Ga0123353_10725316 | 3300010167 | Bacteria | 1389 |
| 154 | Ga0123353_11165610 | 3300010167 | Bacteria | 1015 |
| 155 | Ga0123353_11351902 | 3300010167 | Unclassified | 920 |
| 156 | Ga0123353_11838356 | 3300010167 | Unclassified | 751 |
| 157 | Ga0123353_12827426 | 3300010167 | Unclassified | 568 |
| 158 | Ga0123354_10380568 | 3300010882 | Unclassified | 1219 |
| 159 | Ga0466705_416890 | 3300042612 | Bacteria | 139497 |
| 160 | Ga0466715_057129 | 3300042616 | Bacteria | 23211 |
| 161 | Ga0466726_315195 | 3300042619 | Bacteria | 2870 |
| 162 | Ga0466706_067390 | 3300042599 | Bacteria | 55994 |
| 163 | Ga0466706_073586 | 3300042599 | Bacteria | 52445 |
| 164 | Ga0466707_226801 | 3300042601 | Bacteria | 1123 |
| 165 | Ga0466707_243360 | 3300042601 | Bacteria | 29608 |
| 166 | Ga0466713_129600 | 3300042602 | Bacteria | 11102 |
| 167 | Ga0466717_272478 | 3300042604 | Unclassified | 1240 |
| 168 | Ga0466719_134861 | 3300042606 | Bacteria | 3606 |
| 169 | Ga0233288_1003148 | 3300022232 | Bacteria | 531 |
| 170 | Ga0466693_012538 | 3300042592 | Bacteria | 2330 |
| 171 | Ga0466696_101973 | 3300042596 | Bacteria | 12513 |
| 172 | Ga0466735_025505 | 3300042624 | Bacteria | 1541 |
| 173 | Ga0466725_047128 | 3300042654 | Bacteria | 3673 |
| 174 | 2227473440 | 2225789004 | Bacteria | 905 |
| 175 | JGI24695J34938_10062275 | 3300002450 | Bacteria | 1585 |
| 176 | JGI24702J35022_10000321 | 3300002462 | Bacteria | 28517 |
| 177 | JGI24705J35276_12223894 | 3300002504 | Bacteria | 2554 |
| 178 | JGI24705J35276_12224363 | 3300002504 | Bacteria | 2603 |
| 179 | Ga0068305_10043225 | 3300005083 | Bacteria | 11216 |
| 180 | Ga0123355_11020568 | 3300009826 | Unclassified | 875 |
| 181 | Ga0123355_11159156 | 3300009826 | Unclassified | 795 |
| 182 | Ga0123355_11588314 | 3300009826 | Bacteria | 631 |
| 183 | Ga0123356_10000099 | 3300010049 | Bacteria | 91944 |
| 184 | Ga0123356_10000134 | 3300010049 | Bacteria | 82554 |
| 185 | Ga0123356_10000739 | 3300010049 | Bacteria | 36041 |
| 186 | Ga0123356_10001659 | 3300010049 | Bacteria | 24354 |
| 187 | Ga0123356_10006152 | 3300010049 | Bacteria | 12171 |
| 188 | Ga0123356_10021053 | 3300010049 | Bacteria | 6167 |
| 189 | Ga0123356_10290890 | 3300010049 | Unclassified | 1734 |
| 190 | Ga0123356_10378428 | 3300010049 | Unclassified | 1548 |
| 191 | Ga0123356_10428434 | 3300010049 | Bacteria | 1467 |
| 192 | Ga0123356_10560755 | 3300010049 | Unclassified | 1304 |
| 193 | Ga0123356_10856427 | 3300010049 | Unclassified | 1080 |
| 194 | Ga0123356_11692306 | 3300010049 | Unclassified | 785 |
| 195 | Ga0123356_11776786 | 3300010049 | Unclassified | 766 |
| 196 | Ga0123356_12843281 | 3300010049 | Unclassified | 606 |
| 197 | Ga0123353_10039036 | 3300010167 | Bacteria | 7469 |
| 198 | Ga0123353_10130696 | 3300010167 | Bacteria | 4029 |
| 199 | Ga0123353_10250763 | 3300010167 | Bacteria | 2742 |
| 200 | Ga0123353_10281406 | 3300010167 | Bacteria | 2554 |
| 201 | Ga0123353_10436421 | 3300010167 | Bacteria | 1934 |
| 202 | Ga0123353_10481310 | 3300010167 | Bacteria | 1816 |
| 203 | Ga0123353_10582936 | 3300010167 | Unclassified | 1604 |
| 204 | Ga0123353_10728851 | 3300010167 | Bacteria | 1385 |
| 205 | Ga0123353_10976796 | 3300010167 | Unclassified | 1141 |
| 206 | Ga0123353_11238867 | 3300010167 | Unclassified | 975 |
| 207 | Ga0123353_11471998 | 3300010167 | Unclassified | 870 |
| 208 | Ga0123353_11520423 | 3300010167 | Bacteria | 851 |
| 209 | Ga0123353_12610709 | 3300010167 | Unclassified | 597 |
| 210 | Ga0123354_10884332 | 3300010882 | Unclassified | 588 |
| 211 | Ga0466723_039429 | 3300042618 | Bacteria | 22952 |
| 212 | Ga0466700_259810 | 3300042600 | Bacteria | 2061 |
| 213 | Ga0466707_078642 | 3300042601 | Bacteria | 6932 |
| 214 | Ga0466707_105801 | 3300042601 | Bacteria | 10427 |
| 215 | Ga0466707_166123 | 3300042601 | Bacteria | 25982 |
| 216 | Ga0466707_168629 | 3300042601 | Bacteria | 4510 |
| 217 | Ga0466719_388549 | 3300042606 | Bacteria | 3951 |
| 218 | Ga0466721_080845 | 3300042608 | Bacteria | 5729 |
| 219 | Ga0466733_086335 | 3300042659 | Bacteria | 1249 |
| 220 | Ga0223686_1053253 | 3300021244 | Unclassified | 549 |
| 221 | Ga0466694_001313 | 3300042594 | Unclassified | 1050 |
| 222 | Ga0466704_455987 | 3300042643 | Unclassified | 1012 |
| 223 | Ga0466725_121179 | 3300042654 | Unclassified | 1082 |
| 224 | IMNBL1DRAFT_c0011650 | 3300000062 | Bacteria | 4091 |
| 225 | JGI24702J35022_10039818 | 3300002462 | Bacteria | 2507 |
| 226 | Ga0068305_10001103 | 3300005083 | Bacteria | 12271 |
| 227 | Ga0068305_10214730 | 3300005083 | Bacteria | 4485 |
| 228 | Ga0068305_10239441 | 3300005083 | Bacteria | 1486 |
| 229 | Ga0123355_10000064 | 3300009826 | Bacteria | 113151 |
| 230 | Ga0123355_10000171 | 3300009826 | Bacteria | 79083 |
| 231 | Ga0123355_10028399 | 3300009826 | Bacteria | 9046 |
| 232 | Ga0123356_10030179 | 3300010049 | Bacteria | 5074 |
| 233 | Ga0123356_10062997 | 3300010049 | Bacteria | 3464 |
| 234 | Ga0123356_10084229 | 3300010049 | Bacteria | 3013 |
| 235 | Ga0123356_10104742 | 3300010049 | Bacteria | 2720 |
| 236 | Ga0123356_10107418 | 3300010049 | Bacteria | 2689 |
| 237 | Ga0123356_10107849 | 3300010049 | Bacteria | 2684 |
| 238 | Ga0123356_10138895 | 3300010049 | Bacteria | 2394 |
| 239 | Ga0123356_10471571 | 3300010049 | Unclassified | 1407 |
| 240 | Ga0123356_11118278 | 3300010049 | Bacteria | 956 |
| 241 | Ga0123356_11204971 | 3300010049 | Bacteria | 923 |
| 242 | Ga0123356_11755013 | 3300010049 | Unclassified | 771 |
| 243 | Ga0123356_12797178 | 3300010049 | Unclassified | 611 |
| 244 | Ga0123356_13141600 | 3300010049 | Unclassified | 575 |
| 245 | Ga0123356_13924496 | 3300010049 | Unclassified | 513 |
| 246 | Ga0123353_10176529 | 3300010167 | Bacteria | 3386 |
| 247 | Ga0123353_10179868 | 3300010167 | Bacteria | 3349 |
| 248 | Ga0123353_10536114 | 3300010167 | Bacteria | 1693 |
| 249 | Ga0123353_10731408 | 3300010167 | Unclassified | 1381 |
| 250 | Ga0123353_11630042 | 3300010167 | Unclassified | 813 |
| 251 | Ga0123353_11814797 | 3300010167 | Unclassified | 757 |
| 252 | Ga0123353_12303580 | 3300010167 | Unclassified | 648 |
| 253 | Ga0123353_13316212 | 3300010167 | Unclassified | 513 |
| 254 | Ga0466723_374595 | 3300042618 | Bacteria | 26188 |
| 255 | Ga0466726_053725 | 3300042619 | Bacteria | 1340 |
| 256 | Ga0466726_123696 | 3300042619 | Bacteria | 24670 |
| 257 | Ga0255809_1050735 | 3300022820 | Unclassified | 609 |
| 258 | Ga0466702_091747 | 3300042635 | Bacteria | 3141 |
| 259 | Ga0466725_456701 | 3300042654 | Bacteria | 1588 |
| 260 | Ga0466727_069705 | 3300042655 | Bacteria | 8758 |
| 261 | JGI24702J35022_10012285 | 3300002462 | Bacteria | 4765 |
| 262 | JGI24702J35022_10136879 | 3300002462 | Bacteria | 1364 |
| 263 | JGI24702J35022_10149302 | 3300002462 | Unclassified | 1310 |
| 264 | Ga0123355_10000184 | 3300009826 | Bacteria | 77545 |
| 265 | Ga0123355_10006928 | 3300009826 | Bacteria | 16875 |
| 266 | Ga0123355_10749503 | 3300009826 | Unclassified | 1105 |
| 267 | Ga0123355_11332970 | 3300009826 | Unclassified | 717 |
| 268 | Ga0123355_12139603 | 3300009826 | Unclassified | 513 |
| 269 | Ga0123356_10028189 | 3300010049 | Bacteria | 5261 |
| 270 | Ga0123356_10037740 | 3300010049 | Bacteria | 4505 |
| 271 | Ga0123356_10155243 | 3300010049 | Unclassified | 2278 |
| 272 | Ga0123356_10264455 | 3300010049 | Bacteria | 1806 |
| 273 | Ga0123356_10331863 | 3300010049 | Unclassified | 1638 |
| 274 | Ga0123356_10556543 | 3300010049 | Bacteria | 1308 |
| 275 | Ga0123356_10664667 | 3300010049 | Unclassified | 1209 |
| 276 | Ga0123356_10998248 | 3300010049 | Unclassified | 1007 |
| 277 | Ga0123356_11039101 | 3300010049 | Unclassified | 989 |
| 278 | Ga0123356_11302130 | 3300010049 | Unclassified | 890 |
| 279 | Ga0123356_11601558 | 3300010049 | Bacteria | 806 |
| 280 | Ga0123356_11741579 | 3300010049 | Unclassified | 774 |
| 281 | Ga0123356_11851477 | 3300010049 | Unclassified | 751 |
| 282 | Ga0123356_11855403 | 3300010049 | Unclassified | 750 |
| 283 | Ga0123356_12309522 | 3300010049 | Unclassified | 673 |
| 284 | Ga0123356_12322392 | 3300010049 | Unclassified | 671 |
| 285 | Ga0123356_12752985 | 3300010049 | Bacteria | 616 |
| 286 | Ga0123353_10631371 | 3300010167 | Unclassified | 1522 |
| 287 | Ga0123353_10831460 | 3300010167 | Bacteria | 1269 |
| 288 | Ga0123353_10842164 | 3300010167 | Bacteria | 1259 |
| 289 | Ga0123353_11876425 | 3300010167 | Unclassified | 740 |
| 290 | Ga0466726_326099 | 3300042619 | Unclassified | 2338 |
| 291 | Ga0466700_355350 | 3300042600 | Bacteria | 1769 |
| 292 | Ga0466721_143566 | 3300042608 | Bacteria | 1326 |
| 293 | Ga0415639_003020 | 3300038395 | Bacteria | 16254 |
| 294 | Ga0466699_443097 | 3300042597 | Unclassified | 1410 |
| 295 | Ga0466704_084683 | 3300042643 | Bacteria | 38015 |
| 296 | Ga0466724_08985 | 3300042649 | Bacteria | 2867 |
| 297 | 2227122507 | 2225789004 | Bacteria | 1695 |
| 298 | 2227466320 | 2225789004 | Bacteria | 5137 |
| 299 | JGI24702J35022_10135530 | 3300002462 | Bacteria | 1370 |
| 300 | JGI24702J35022_10761007 | 3300002462 | Unclassified | 603 |
| 301 | JGI24703J35330_11719314 | 3300002501 | Bacteria | 2348 |
| 302 | Ga0123357_10169389 | 3300009784 | Bacteria | 2589 |
| 303 | Ga0123357_10316009 | 3300009784 | Bacteria | 1551 |
| 304 | Ga0123357_10453929 | 3300009784 | Bacteria | 1109 |
| 305 | Ga0123355_10212954 | 3300009826 | Bacteria | 2796 |
| 306 | Ga0123355_10551284 | 3300009826 | Unclassified | 1394 |
| 307 | Ga0123355_10937924 | 3300009826 | Unclassified | 932 |
| 308 | Ga0123355_11131883 | 3300009826 | Bacteria | 809 |
| 309 | Ga0123355_11519677 | 3300009826 | Unclassified | 651 |
| 310 | Ga0123356_10040628 | 3300010049 | Bacteria | 4333 |
| 311 | Ga0123356_10095059 | 3300010049 | Unclassified | 2848 |
| 312 | Ga0123356_10165035 | 3300010049 | Unclassified | 2218 |
| 313 | Ga0123356_10237599 | 3300010049 | Unclassified | 1891 |
| 314 | Ga0123356_10258803 | 3300010049 | Bacteria | 1823 |
| 315 | Ga0123356_10273045 | 3300010049 | Unclassified | 1781 |
| 316 | Ga0123356_10309541 | 3300010049 | Unclassified | 1688 |
| 317 | Ga0123356_10579204 | 3300010049 | Unclassified | 1285 |
| 318 | Ga0123356_10692663 | 3300010049 | Unclassified | 1188 |
| 319 | Ga0123356_11110515 | 3300010049 | Unclassified | 959 |
| 320 | Ga0123356_13504728 | 3300010049 | Bacteria | 544 |
| 321 | Ga0123353_10008423 | 3300010167 | Bacteria | 14077 |
| 322 | Ga0123353_10024127 | 3300010167 | Bacteria | 9226 |
| 323 | Ga0123353_10137913 | 3300010167 | Bacteria | 3911 |
| 324 | Ga0123353_10196731 | 3300010167 | Bacteria | 3177 |
| 325 | Ga0123353_11192416 | 3300010167 | Unclassified | 1000 |
| 326 | Ga0123353_11365727 | 3300010167 | Unclassified | 914 |
| 327 | Ga0123353_11455767 | 3300010167 | Unclassified | 876 |
| 328 | Ga0123353_12066795 | 3300010167 | Unclassified | 695 |
| 329 | Ga0123353_12128103 | 3300010167 | Unclassified | 682 |
| 330 | Ga0123353_12356694 | 3300010167 | Unclassified | 638 |
| 331 | Ga0123354_10840209 | 3300010882 | Unclassified | 612 |
| 332 | Ga0123354_11074682 | 3300010882 | Unclassified | 512 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 22 | 102 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.