Protein Family IF00774
Metagenome
Isolate
141
Members
79
Samples
108
Scaffolds
201.27
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10008518|JGI24702J35022_100085182
- Length
- 233 aa
- Sequence
- MEKEKTGTVYDIDVMVADESHEKYVDTILETIENSAKVRGTGIAKRSHDYVAQKMREGKVIIALDGDDFAGFTYIESWGNKQYVATSGLIVADKYRNKGLARRIKHASFQLARLRWPKAKIFSLTSGSAVMKLNTELGYFPVTFADLTDDEAFWRGCNGCSNYDVLMRTQRRYCICTAMLFDPADERCLLLEKMCHSFAQKEAKKRKAEVKNGVENSSIIVNQVKKNVLSGN*
Sample Types
Isolate
23.4%
Metagenome
76.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
36.4%
Termitidae
20.8%
Kalotermitidae
18.2%
Rhinotermitidae
7.8%
Unclassified
5.2%
Termopsidae
5.2%
Passalidae
3.9%
Hodotermitidae
1.3%
Hydrophilidae
1.3%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 2 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 3 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 4 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 5 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 6 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 7 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 8 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 9 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 10 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 16 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 17 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 18 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 19 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 22 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 23 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 36 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 37 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 38 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 60 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 61 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 62 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 65 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 66 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 67 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 68 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 76 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 77 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 2 | Ga0466708_330262 | 3300042652 | Bacteria | 27220 |
| 3 | Ga0466727_190108 | 3300042655 | Bacteria | 14426 |
| 4 | Ga0466722_263608 | 3300042609 | Bacteria | 34147 |
| 5 | Ga0466705_448736 | 3300042612 | Bacteria | 6019 |
| 6 | Ga0466711_137330 | 3300042615 | Bacteria | 35994 |
| 7 | Ga0466715_208835 | 3300042616 | Bacteria | 4662 |
| 8 | Ga0466723_199824 | 3300042618 | Bacteria | 5378 |
| 9 | Ga0466728_165817 | 3300042620 | Bacteria | 1312 |
| 10 | IMNBL1DRAFT_c0078531 | 3300000062 | Bacteria | 931 |
| 11 | Ga0123356_10013145 | 3300010049 | Bacteria | 8004 |
| 12 | Ga0466705_133625 | 3300042612 | Bacteria | 4588 |
| 13 | Ga0466733_124204 | 3300042659 | Bacteria | 2991 |
| 14 | Ga0466729_266607 | 3300042621 | Bacteria | 8002 |
| 15 | Ga0466706_133932 | 3300042599 | Bacteria | 8463 |
| 16 | Ga0466707_277030 | 3300042601 | Bacteria | 3684 |
| 17 | Ga0466707_347425 | 3300042601 | Bacteria | 8354 |
| 18 | Ga0466716_333412 | 3300042605 | Bacteria | 3747 |
| 19 | Ga0466728_306748 | 3300042620 | Bacteria | 24885 |
| 20 | Ga0466728_356489 | 3300042620 | Bacteria | 10989 |
| 21 | Ga0466729_051045 | 3300042621 | Bacteria | 12078 |
| 22 | Ga0466691_010037 | 3300042593 | Bacteria | 10367 |
| 23 | Ga0466696_353529 | 3300042596 | Bacteria | 7911 |
| 24 | JGI24702J35022_10024443 | 3300002462 | Bacteria | 3265 |
| 25 | Ga0466705_317509 | 3300042612 | Bacteria | 8974 |
| 26 | Ga0466733_093307 | 3300042659 | Bacteria | 1444 |
| 27 | Ga0466703_103094 | 3300042636 | Bacteria | 14416 |
| 28 | Ga0466727_119042 | 3300042655 | Bacteria | 8803 |
| 29 | Ga0466713_041042 | 3300042602 | Bacteria | 19187 |
| 30 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 31 | Ga0466716_224142 | 3300042605 | Bacteria | 1365 |
| 32 | Ga0466711_111925 | 3300042615 | Bacteria | 13247 |
| 33 | Ga0466715_044469 | 3300042616 | Bacteria | 20161 |
| 34 | Ga0466726_271607 | 3300042619 | Bacteria | 3044 |
| 35 | Ga0466690_141500 | 3300042590 | Bacteria | 4349 |
| 36 | Ga0466693_296298 | 3300042592 | Bacteria | 1402 |
| 37 | JGI24702J35022_10000190 | 3300002462 | Bacteria | 32930 |
| 38 | Ga0068302_10035131 | 3300005071 | Bacteria | 6636 |
| 39 | Ga0466703_198609 | 3300042636 | Bacteria | 8838 |
| 40 | Ga0466703_422052 | 3300042636 | Bacteria | 8727 |
| 41 | Ga0466708_224946 | 3300042652 | Bacteria | 22929 |
| 42 | Ga0466727_108549 | 3300042655 | Bacteria | 17021 |
| 43 | Ga0466713_077783 | 3300042602 | Bacteria | 8388 |
| 44 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 45 | Ga0466719_525073 | 3300042606 | Bacteria | 16045 |
| 46 | Ga0466715_019255 | 3300042616 | Bacteria | 20255 |
| 47 | Ga0466690_079211 | 3300042590 | Bacteria | 4025 |
| 48 | Ga0466695_241634 | 3300042595 | Bacteria | 1904 |
| 49 | Ga0466696_031717 | 3300042596 | Bacteria | 4905 |
| 50 | Ga0466696_100380 | 3300042596 | Bacteria | 2778 |
| 51 | JGI24705J35276_12238515 | 3300002504 | Bacteria | 24729 |
| 52 | Ga0068305_10415446 | 3300005083 | Bacteria | 1778 |
| 53 | Ga0466705_185186 | 3300042612 | Unclassified | 1411 |
| 54 | Ga0466732_087706 | 3300042656 | Bacteria | 1655 |
| 55 | Ga0466733_132399 | 3300042659 | Bacteria | 35400 |
| 56 | Ga0466731_136611 | 3300042622 | Bacteria | 2645 |
| 57 | Ga0466730_093313 | 3300042625 | Unclassified | 2507 |
| 58 | Ga0466703_114450 | 3300042636 | Bacteria | 5480 |
| 59 | Ga0466704_200286 | 3300042643 | Bacteria | 8231 |
| 60 | Ga0466719_176856 | 3300042606 | Bacteria | 5125 |
| 61 | Ga0466719_376968 | 3300042606 | Bacteria | 2454 |
| 62 | Ga0466690_013306 | 3300042590 | Bacteria | 11978 |
| 63 | 2227496580 | 2225789004 | Unclassified | 3916 |
| 64 | IMNBL1DRAFT_c0017621 | 3300000062 | Bacteria | 2998 |
| 65 | Ga0068305_10020971 | 3300005083 | Bacteria | 33055 |
| 66 | Ga0466733_024711 | 3300042659 | Bacteria | 63451 |
| 67 | Ga0466704_486621 | 3300042643 | Bacteria | 6328 |
| 68 | Ga0466727_188460 | 3300042655 | Bacteria | 6030 |
| 69 | Ga0466701_074493 | 3300042598 | Bacteria | 3597 |
| 70 | Ga0466707_354392 | 3300042601 | Bacteria | 12097 |
| 71 | Ga0466716_441587 | 3300042605 | Bacteria | 5758 |
| 72 | Ga0466711_161163 | 3300042615 | Bacteria | 17839 |
| 73 | Ga0466711_231558 | 3300042615 | Bacteria | 14810 |
| 74 | Ga0265387_1003556 | 3300024582 | Bacteria | 2143 |
| 75 | Ga0466656_028563 | 3300042550 | Bacteria | 16060 |
| 76 | Ga0466690_180282 | 3300042590 | Bacteria | 25954 |
| 77 | Ga0466690_336420 | 3300042590 | Bacteria | 10674 |
| 78 | IMNBL1DRAFT_c0000168 | 3300000062 | Bacteria | 58839 |
| 79 | JGI24702J35022_10000615 | 3300002462 | Bacteria | 21682 |
| 80 | Ga0068305_10032167 | 3300005083 | Bacteria | 15858 |
| 81 | Ga0072941_1317022 | 3300005201 | Bacteria | 1081 |
| 82 | Ga0123357_10002062 | 3300009784 | Bacteria | 22044 |
| 83 | Ga0466703_135243 | 3300042636 | Bacteria | 1977 |
| 84 | Ga0466704_505823 | 3300042643 | Bacteria | 19480 |
| 85 | Ga0466708_349535 | 3300042652 | Bacteria | 6314 |
| 86 | Ga0466715_613283 | 3300042616 | Bacteria | 7780 |
| 87 | Ga0466726_091824 | 3300042619 | Bacteria | 1628 |
| 88 | Ga0466729_123324 | 3300042621 | Bacteria | 7053 |
| 89 | Ga0466691_108850 | 3300042593 | Bacteria | 6164 |
| 90 | JGI24702J35022_10008518 | 3300002462 | Bacteria | 5804 |
| 91 | JGI24702J35022_10011567 | 3300002462 | Bacteria | 4917 |
| 92 | Ga0123354_10001081 | 3300010882 | Bacteria | 31466 |
| 93 | Ga0466735_138101 | 3300042624 | Bacteria | 2154 |
| 94 | Ga0466703_393730 | 3300042636 | Bacteria | 3938 |
| 95 | Ga0466709_011326 | 3300042648 | Bacteria | 23746 |
| 96 | Ga0466713_077725 | 3300042602 | Bacteria | 10308 |
| 97 | Ga0466719_209125 | 3300042606 | Bacteria | 3289 |
| 98 | Ga0466722_043264 | 3300042609 | Bacteria | 4667 |
| 99 | Ga0466722_187170 | 3300042609 | Bacteria | 3410 |
| 100 | Ga0466723_108082 | 3300042618 | Bacteria | 9241 |
| 101 | Ga0466726_170449 | 3300042619 | Bacteria | 3008 |
| 102 | Ga0466728_325649 | 3300042620 | Bacteria | 7234 |
| 103 | Ga0466692_009647 | 3300042591 | Bacteria | 10786 |
| 104 | 2226991485 | 2225789003 | Bacteria | 7193 |
| 105 | IMNBL1DRAFT_c0002288 | 3300000062 | Bacteria | 13463 |
| 106 | JGI24698J34947_10030403 | 3300002449 | Bacteria | 2848 |
| 107 | Ga0123356_10702570 | 3300010049 | Bacteria | 1180 |
| 108 | Ga0123353_10354202 | 3300010167 | Bacteria | 2210 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.