Protein Family IF00748

Metagenome Isolate
138 Members
73 Samples
110 Scaffolds
219.61 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10000989|JGI24702J35022_100009898
Length
252 aa
Sequence
LESDSLIIFCLLFKNCTYIRALFVRFYDFEMIQTTGIIKSFDKLQVLKGIDLHVEKKEIVAIVGPSGAGKTTLLQIMGTLDKPDGGNVLIDGIDPFGLNEKDMSHFRNRHIGFVFQFHQLLPEFTSLENVMIPMLIAGEKAKTAEKKAKELLDFLQMADRMMHKPAELSGGEKQRIAVARALINDPSVILADEPSGSLDTKNKEELHALFFDLRDKLGQTFVIVTHDVNLAKLTDRIIQMKDGVIAPSILT*

πŸ“Š Sample Types

Isolate 20.3%
Metagenome 79.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 29.2%
Termitidae 27.8%
Kalotermitidae 18.1%
Unclassified 13.9%
Rhinotermitidae 4.2%
Termopsidae 2.8%
Passalidae 2.8%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 2923982719 Parabacteroides sp. 52 Isolate Blattidae
9 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
10 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
11 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3004667792 Bacteroides sp. 519 Isolate Blattidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
26 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
27 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
36 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
37 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
43 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
44 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
45 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
46 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
47 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
51 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
52 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
53 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
56 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
57 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
58 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
59 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
60 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
61 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
62 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
63 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
64 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
65 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
67 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
68 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
69 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
70 2920168565 Paludibacter sp. 221 Isolate Blattidae
71 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
72 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
73 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_124222 3300042611 Bacteria 1637
2 Ga0466711_288675 3300042615 Bacteria 20859
3 Ga0466711_415995 3300042615 Bacteria 11652
4 Ga0466715_181610 3300042616 Bacteria 4284
5 Ga0466723_226467 3300042618 Bacteria 13219
6 Ga0466729_173861 3300042621 Bacteria 5830
7 Ga0466706_125714 3300042599 Bacteria 14827
8 Ga0466713_058794 3300042602 Bacteria 46658
9 Ga0466714_134258 3300042603 Bacteria 4633
10 2227519938 2225789004 Bacteria 3358
11 IMNBL1DRAFT_c0001800 3300000062 Bacteria 15642
12 JGI24702J35022_10013758 3300002462 Bacteria 4474
13 JGI24705J35276_12238557 3300002504 Bacteria 26549
14 Ga0466733_066803 3300042659 Bacteria 1833
15 Ga0466690_199847 3300042590 Bacteria 3086
16 Ga0466693_267612 3300042592 Bacteria 2548
17 Ga0466691_204020 3300042593 Bacteria 6008
18 Ga0466696_023674 3300042596 Bacteria 3211
19 Ga0466701_002954 3300042598 Bacteria 1209
20 Ga0466728_451299 3300042620 Bacteria 2227
21 Ga0466713_028749 3300042602 Bacteria 28146
22 2227495473 2225789004 Unclassified 3951
23 IMNBL1DRAFT_c0010101 3300000062 Bacteria 4568
24 JGI24702J35022_10000989 3300002462 Bacteria 17803
25 Ga0068305_10047658 3300005083 Bacteria 8597
26 Ga0072941_1182092 3300005201 Bacteria 3844
27 Ga0123357_10002184 3300009784 Bacteria 21576
28 Ga0466704_012661 3300042643 Bacteria 4039
29 Ga0466704_303500 3300042643 Bacteria 20207
30 Ga0466725_016791 3300042654 Bacteria 21213
31 Ga0466732_080661 3300042656 Bacteria 5256
32 Ga0466733_198828 3300042659 Bacteria 7420
33 Ga0466690_091124 3300042590 Bacteria 36086
34 Ga0466692_144683 3300042591 Bacteria 28602
35 Ga0466693_392870 3300042592 Bacteria 1884
36 Ga0466691_078732 3300042593 Bacteria 3961
37 Ga0466691_088639 3300042593 Bacteria 19618
38 Ga0123355_10434800 3300009826 Bacteria 1666
39 Ga0123353_10987715 3300010167 Bacteria 1133
40 Ga0466706_233555 3300042599 Bacteria 45210
41 Ga0466707_345958 3300042601 Bacteria 40317
42 2227087500 2225789004 Bacteria 1849
43 2227140834 2225789004 Bacteria 1622
44 JGI24702J35022_10003001 3300002462 Bacteria 10216
45 Ga0466731_134563 3300042622 Bacteria 1155
46 Ga0466735_109538 3300042624 Bacteria 3497
47 Ga0466690_092511 3300042590 Bacteria 2263
48 Ga0466690_147102 3300042590 Bacteria 14491
49 Ga0123353_10333109 3300010167 Bacteria 2296
50 Ga0123354_10016375 3300010882 Bacteria 11617
51 Ga0466715_406776 3300042616 Bacteria 11716
52 Ga0466714_139060 3300042603 Bacteria 50968
53 2227247461 2225789004 Bacteria 31587
54 JGI24699J35502_11134229 3300002509 Bacteria 98606
55 Ga0466735_004863 3300042624 Bacteria 16044
56 Ga0466735_104774 3300042624 Bacteria 1608
57 Ga0466703_119224 3300042636 Bacteria 10231
58 Ga0466727_198985 3300042655 Bacteria 2338
59 Ga0466691_071708 3300042593 Bacteria 18929
60 Ga0466691_145457 3300042593 Bacteria 34874
61 Ga0466696_209402 3300042596 Bacteria 7754
62 Ga0466701_004377 3300042598 Bacteria 4875
63 Ga0466715_437866 3300042616 Bacteria 10359
64 Ga0466706_140857 3300042599 Bacteria 123527
65 Ga0466714_029406 3300042603 Bacteria 41959
66 Ga0466717_205453 3300042604 Unclassified 2810
67 Ga0466735_102942 3300042624 Bacteria 2326
68 Ga0466733_035378 3300042659 Bacteria 72401
69 Ga0466696_036472 3300042596 Bacteria 2963
70 Ga0466696_300391 3300042596 Bacteria 6821
71 Ga0123353_11251477 3300010167 Bacteria 968
72 Ga0466715_567116 3300042616 Bacteria 22152
73 Ga0466717_165218 3300042604 Bacteria 1595
74 Ga0466716_176243 3300042605 Bacteria 5676
75 Ga0466719_125517 3300042606 Bacteria 1573
76 Ga0466722_146419 3300042609 Bacteria 5011
77 IMNBL1DRAFT_c0000112 3300000062 Bacteria 72967
78 IMNBL1DRAFT_c0000571 3300000062 Bacteria 29765
79 IMNBL1DRAFT_c0039194 3300000062 Bacteria 1620
80 JGI24702J35022_10005602 3300002462 Bacteria 7320
81 JGI24702J35022_10006225 3300002462 Bacteria 6916
82 Ga0466703_345209 3300042636 Bacteria 19451
83 Ga0466705_156772 3300042612 Bacteria 3875
84 Ga0466656_327867 3300042550 Bacteria 5382
85 Ga0466690_427464 3300042590 Bacteria 23231
86 Ga0466716_143652 3300042605 Bacteria 1192
87 JGI24705J35276_12234362 3300002504 Bacteria 5455
88 Ga0466703_193143 3300042636 Bacteria 7650
89 Ga0466704_206895 3300042643 Bacteria 10145
90 Ga0466704_242149 3300042643 Bacteria 5574
91 Ga0466704_479765 3300042643 Bacteria 17636
92 Ga0466725_403336 3300042654 Bacteria 14953
93 Ga0466727_229437 3300042655 Bacteria 2730
94 Ga0466705_142107 3300042612 Bacteria 26909
95 Ga0466696_001911 3300042596 Bacteria 82336
96 Ga0123356_10076752 3300010049 Bacteria 3149
97 Ga0466715_129051 3300042616 Bacteria 2017
98 Ga0466715_163266 3300042616 Bacteria 6579
99 Ga0466715_410700 3300042616 Unclassified 1925
100 Ga0466718_037637 3300042617 Bacteria 3143
101 Ga0466701_082585 3300042598 Bacteria 4504
102 Ga0466706_028547 3300042599 Bacteria 1608
103 Ga0466706_148602 3300042599 Bacteria 49418
104 Ga0466707_250018 3300042601 Bacteria 4062
105 Ga0466714_041819 3300042603 Bacteria 104465
106 Ga0466722_154859 3300042609 Bacteria 2203
107 IMNBL1DRAFT_c0035365 3300000062 Bacteria 1762
108 JGI24695J34938_10155291 3300002450 Bacteria 939
109 Ga0466731_016398 3300042622 Bacteria 1867
110 Ga0466708_210049 3300042652 Bacteria 11481

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 47 195 0.89

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.