Protein Family IF00673
Metagenome
Isolate
157
Members
51
Samples
134
Scaffolds
218
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10020257|JGI24695J34938_100202572
- Length
- 239 aa
- Sequence
- MSWQGWYNNNIEGVSIMLENIMDFSLVHKASSLSILDVLAALAVSFAMGLFIFFVYKKTFRGVMYSQSFAISLIAMNLITCLIIIAVSTNLIAALGMVGALSIVRFRTVVKEPLDLVYLFWSIAIGIIIGVGLIPLAVIGSILIGCILFVFVNKKDGDTPYVVVVNCENEKTEMESLELIKNRTKKQVIKSKSVSKNGIELTVEVRLSGETVSFLNELLGLPGVSNAVLVSYNGNYYM*
Sample Types
Isolate
14.7%
Metagenome
85.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
43.1%
Termitidae
35.3%
Kalotermitidae
5.9%
Passalidae
5.9%
Termopsidae
3.9%
Stratiomyidae
2.0%
Hodotermitidae
2.0%
Rhinotermitidae
2.0%
Taxonomy
Archaea
4
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 2 | 2772190976 | Unclassified Bathyarchaeota Co191P4bin18 | Isolate | Unclassified |
| 3 | 2772190989 | Unclassified Bathyarchaeota Cu122P1bin20 | Isolate | Unclassified |
| 4 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 19 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 20 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 21 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 22 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 23 | 2772190988 | Unclassified Bathyarchaeota Co191P1bin46 | Isolate | Unclassified |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 28 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 29 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 30 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 35 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 36 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 39 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 40 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 41 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 42 | 2772190974 | Unclassified Bathyarchaeota Co191P3bin4 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 2820866620 | Unclassified Actinobacteria Lab288P3bin139 | Isolate | Unclassified |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_143877 | 3300042659 | Bacteria | 1374 |
| 2 | Ga0123355_10079253 | 3300009826 | Bacteria | 5246 |
| 3 | Ga0123356_10704778 | 3300010049 | Bacteria | 1179 |
| 4 | Ga0123353_10048762 | 3300010167 | Bacteria | 6745 |
| 5 | Ga0123353_10882315 | 3300010167 | Bacteria | 1221 |
| 6 | AustNasuHG_c1000161 | 3300000089 | Bacteria | 21420 |
| 7 | JGI24702J35022_10000233 | 3300002462 | Bacteria | 31657 |
| 8 | JGI24702J35022_10032581 | 3300002462 | Bacteria | 2790 |
| 9 | JGI24703J35330_11747471 | 3300002501 | Bacteria | 6999 |
| 10 | Ga0466706_054890 | 3300042599 | Bacteria | 14004 |
| 11 | Ga0466706_128815 | 3300042599 | Bacteria | 42186 |
| 12 | Ga0466714_091702 | 3300042603 | Bacteria | 8148 |
| 13 | Ga0466717_057671 | 3300042604 | Bacteria | 6116 |
| 14 | Ga0466702_373131 | 3300042635 | Bacteria | 1880 |
| 15 | Ga0466703_354725 | 3300042636 | Bacteria | 4059 |
| 16 | Ga0466733_154965 | 3300042659 | Bacteria | 1509 |
| 17 | Ga0123355_10003320 | 3300009826 | Bacteria | 23024 |
| 18 | Ga0123355_10084850 | 3300009826 | Unclassified | 5042 |
| 19 | Ga0123353_10185598 | 3300010167 | Bacteria | 3289 |
| 20 | Ga0123353_10197263 | 3300010167 | Bacteria | 3172 |
| 21 | Ga0123353_10236613 | 3300010167 | Bacteria | 2842 |
| 22 | Ga0123353_10250949 | 3300010167 | Unclassified | 2740 |
| 23 | Ga0123353_10504881 | 3300010167 | Bacteria | 1761 |
| 24 | Ga0123353_11026038 | 3300010167 | Bacteria | 1105 |
| 25 | Ga0466693_382906 | 3300042592 | Bacteria | 1847 |
| 26 | JGI24702J35022_10001688 | 3300002462 | Bacteria | 13699 |
| 27 | JGI24702J35022_10026317 | 3300002462 | Bacteria | 3135 |
| 28 | Ga0466706_002152 | 3300042599 | Bacteria | 1136 |
| 29 | Ga0466722_199350 | 3300042609 | Bacteria | 65701 |
| 30 | Ga0466702_112467 | 3300042635 | Bacteria | 1400 |
| 31 | Ga0466702_154979 | 3300042635 | Bacteria | 1166 |
| 32 | Ga0466702_446070 | 3300042635 | Unclassified | 2610 |
| 33 | Ga0123355_10414705 | 3300009826 | Unclassified | 1726 |
| 34 | Ga0123353_10018085 | 3300010167 | Bacteria | 10403 |
| 35 | Ga0123353_10243701 | 3300010167 | Bacteria | 2790 |
| 36 | Ga0123353_10392059 | 3300010167 | Bacteria | 2071 |
| 37 | Ga0466693_409566 | 3300042592 | Bacteria | 1462 |
| 38 | JGI24702J35022_10005672 | 3300002462 | Bacteria | 7280 |
| 39 | JGI24702J35022_10120635 | 3300002462 | Bacteria | 1448 |
| 40 | Ga0466706_201603 | 3300042599 | Bacteria | 3741 |
| 41 | Ga0466713_048926 | 3300042602 | Bacteria | 4892 |
| 42 | Ga0466713_075955 | 3300042602 | Bacteria | 4398 |
| 43 | Ga0466702_360132 | 3300042635 | Unclassified | 1161 |
| 44 | Ga0123355_10049387 | 3300009826 | Bacteria | 6840 |
| 45 | Ga0123355_10175355 | 3300009826 | Bacteria | 3194 |
| 46 | Ga0123355_11087132 | 3300009826 | Bacteria | 834 |
| 47 | Ga0123356_10010811 | 3300010049 | Bacteria | 8926 |
| 48 | Ga0123356_10061764 | 3300010049 | Bacteria | 3499 |
| 49 | Ga0123353_10016968 | 3300010167 | Bacteria | 10673 |
| 50 | Ga0123353_10065977 | 3300010167 | Bacteria | 5810 |
| 51 | Ga0123353_10170091 | 3300010167 | Bacteria | 3460 |
| 52 | Ga0466693_355653 | 3300042592 | Bacteria | 2133 |
| 53 | JGI24695J34938_10020257 | 3300002450 | Bacteria | 3277 |
| 54 | JGI24702J35022_10096544 | 3300002462 | Bacteria | 1613 |
| 55 | JGI24702J35022_10149374 | 3300002462 | Bacteria | 1310 |
| 56 | JGI24702J35022_10163024 | 3300002462 | Bacteria | 1257 |
| 57 | JGI24702J35022_10193090 | 3300002462 | Bacteria | 1162 |
| 58 | JGI24696J40584_12961422 | 3300002834 | Bacteria | 15661 |
| 59 | Ga0466706_077302 | 3300042599 | Bacteria | 24947 |
| 60 | Ga0466706_287244 | 3300042599 | Bacteria | 24490 |
| 61 | Ga0466714_005420 | 3300042603 | Bacteria | 1039 |
| 62 | Ga0466714_019751 | 3300042603 | Bacteria | 1492 |
| 63 | Ga0466704_579363 | 3300042643 | Bacteria | 7001 |
| 64 | Ga0123355_10177158 | 3300009826 | Bacteria | 3173 |
| 65 | Ga0123355_10375150 | 3300009826 | Bacteria | 1859 |
| 66 | Ga0123356_10024140 | 3300010049 | Bacteria | 5722 |
| 67 | Ga0123353_10015830 | 3300010167 | Bacteria | 10982 |
| 68 | Ga0123353_10101731 | 3300010167 | Bacteria | 4632 |
| 69 | Ga0123353_10155264 | 3300010167 | Unclassified | 3649 |
| 70 | Ga0123353_10834648 | 3300010167 | Bacteria | 1266 |
| 71 | Ga0123353_11397918 | 3300010167 | Bacteria | 900 |
| 72 | Ga0123354_10185792 | 3300010882 | Bacteria | 2352 |
| 73 | Ga0466694_026243 | 3300042594 | Bacteria | 3853 |
| 74 | JGI24702J35022_10013690 | 3300002462 | Unclassified | 4486 |
| 75 | Ga0068302_10014638 | 3300005071 | Bacteria | 3483 |
| 76 | Ga0466733_002179 | 3300042659 | Bacteria | 1872 |
| 77 | Ga0466733_047214 | 3300042659 | Bacteria | 1325 |
| 78 | Ga0123355_10021210 | 3300009826 | Bacteria | 10396 |
| 79 | Ga0123355_10272753 | 3300009826 | Bacteria | 2348 |
| 80 | Ga0123355_10468966 | 3300009826 | Bacteria | 1574 |
| 81 | Ga0123355_10592918 | 3300009826 | Bacteria | 1319 |
| 82 | Ga0123355_10936695 | 3300009826 | Unclassified | 933 |
| 83 | Ga0123356_10129060 | 3300010049 | Bacteria | 2474 |
| 84 | Ga0123353_10314952 | 3300010167 | Bacteria | 2378 |
| 85 | Ga0123353_10427894 | 3300010167 | Bacteria | 1959 |
| 86 | Ga0123353_10486419 | 3300010167 | Bacteria | 1804 |
| 87 | Ga0123353_10625923 | 3300010167 | Bacteria | 1530 |
| 88 | Ga0123353_10724169 | 3300010167 | Bacteria | 1391 |
| 89 | Ga0123353_10753277 | 3300010167 | Bacteria | 1355 |
| 90 | Ga0466726_218668 | 3300042619 | Bacteria | 3503 |
| 91 | Ga0466726_262169 | 3300042619 | Bacteria | 1458 |
| 92 | Ga0466693_385393 | 3300042592 | Unclassified | 12560 |
| 93 | IMNBL1DRAFT_c0000301 | 3300000062 | Unclassified | 42034 |
| 94 | JGI24702J35022_10033988 | 3300002462 | Bacteria | 2727 |
| 95 | JGI24703J35330_11740694 | 3300002501 | Bacteria | 3441 |
| 96 | JGI24696J40584_12944797 | 3300002834 | Bacteria | 1826 |
| 97 | Ga0068305_10510710 | 3300005083 | Bacteria | 2177 |
| 98 | Ga0466706_104854 | 3300042599 | Unclassified | 8963 |
| 99 | Ga0466713_034985 | 3300042602 | Bacteria | 1438 |
| 100 | Ga0466714_051330 | 3300042603 | Bacteria | 34645 |
| 101 | Ga0466702_002601 | 3300042635 | Bacteria | 1860 |
| 102 | Ga0466702_232014 | 3300042635 | Bacteria | 6206 |
| 103 | Ga0466733_085001 | 3300042659 | Unclassified | 1876 |
| 104 | Ga0123356_10008123 | 3300010049 | Bacteria | 10453 |
| 105 | Ga0123356_10012643 | 3300010049 | Bacteria | 8183 |
| 106 | Ga0123356_10048568 | 3300010049 | Bacteria | 3949 |
| 107 | Ga0123353_10013302 | 3300010167 | Unclassified | 11780 |
| 108 | Ga0123353_10152425 | 3300010167 | Bacteria | 3688 |
| 109 | Ga0466693_430635 | 3300042592 | Bacteria | 4648 |
| 110 | 2227024805 | 2225789003 | Bacteria | 4832 |
| 111 | 2227191911 | 2225789004 | Bacteria | 34026 |
| 112 | JGI24702J35022_10000111 | 3300002462 | Bacteria | 38574 |
| 113 | JGI24702J35022_10000200 | 3300002462 | Bacteria | 32566 |
| 114 | JGI24702J35022_10018567 | 3300002462 | Bacteria | 3789 |
| 115 | JGI24696J40584_12930602 | 3300002834 | Bacteria | 1472 |
| 116 | Ga0466713_030690 | 3300042602 | Bacteria | 44684 |
| 117 | Ga0466713_058314 | 3300042602 | Bacteria | 36579 |
| 118 | Ga0466714_017343 | 3300042603 | Bacteria | 1235 |
| 119 | Ga0466714_044102 | 3300042603 | Bacteria | 9923 |
| 120 | Ga0466714_161292 | 3300042603 | Bacteria | 1818 |
| 121 | Ga0466734_019072 | 3300042623 | Bacteria | 1039 |
| 122 | Ga0466702_465901 | 3300042635 | Bacteria | 4199 |
| 123 | Ga0466703_384219 | 3300042636 | Bacteria | 4470 |
| 124 | Ga0123355_10977873 | 3300009826 | Unclassified | 903 |
| 125 | Ga0123353_10114205 | 3300010167 | Bacteria | 4347 |
| 126 | Ga0466715_607828 | 3300042616 | Bacteria | 77672 |
| 127 | Ga0466656_288663 | 3300042550 | Bacteria | 1128 |
| 128 | JGI24702J35022_10025982 | 3300002462 | Bacteria | 3157 |
| 129 | JGI24702J35022_10103826 | 3300002462 | Bacteria | 1558 |
| 130 | Ga0466706_064582 | 3300042599 | Unclassified | 1388 |
| 131 | Ga0466706_201160 | 3300042599 | Bacteria | 38682 |
| 132 | Ga0466698_228107 | 3300042610 | Bacteria | 1477 |
| 133 | Ga0466734_027469 | 3300042623 | Bacteria | 2290 |
| 134 | Ga0466702_321591 | 3300042635 | Unclassified | 1453 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF16316 | DUF4956 | Domain of unknown function (DUF4956) | 47 | 188 | 0.72 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.