Protein Family IF00664

Metagenome Isolate
140 Members
53 Samples
108 Scaffolds
223.69 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10014872|JGI24695J34938_100148724
Length
263 aa
Sequence
MHCSDTPAKQNHLTFTNRSDRLNLNITVIFHITRNEEIMAVTYEALKKDEQVCAYIQAGNDALKALGFTEHSFPHLCHTAETAAMILKEIGHCDDTVELAKIAGLLHDIGNMLNRAFHAASGAEIARTILERCGMPYKDIGVVCSAIGNHDEGSGKPVNVISAALIIADKTDVRRSRVQETCMENILADIHDRVNYAVTRAEIQTIHSGAKLFIRLCLDIDIDFTPVLDYFEIFLTRMVLCRRAAAFLGAEFELFINDSKIV*

📊 Sample Types

Isolate 22.9%
Metagenome 77.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 54.7%
Termitidae 32.1%
Passalidae 3.8%
Blattidae 3.8%
Rhinotermitidae 1.9%
Hodotermitidae 1.9%
Kalotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
2 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
3 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
4 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
5 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
6 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
7 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
8 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
13 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
14 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
15 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
16 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
17 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
18 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
19 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
20 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
23 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
24 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
25 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
28 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
29 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
30 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
44 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
45 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
46 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
47 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
48 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
49 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
50 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
51 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_040289 3300038395 Bacteria 3400
2 Ga0415639_111594 3300038395 Bacteria 4494
3 Ga0123355_10001981 3300009826 Bacteria 28905
4 Ga0123355_10055369 3300009826 Bacteria 6423
5 Ga0123355_10085380 3300009826 Unclassified 5023
6 Ga0123355_10207922 3300009826 Bacteria 2844
7 Ga0123355_10268789 3300009826 Unclassified 2373
8 Ga0123355_10624565 3300009826 Bacteria 1268
9 Ga0123356_10168532 3300010049 Bacteria 2198
10 Ga0123353_10327073 3300010167 Bacteria 2323
11 2227560724 2225789004 Bacteria 14549
12 IMNBL1DRAFT_c0004220 3300000062 Bacteria 8726
13 IMNBL1DRAFT_c0071688 3300000062 Bacteria 998
14 JGI24697J35500_11274963 3300002507 Bacteria 28413
15 Ga0466733_038690 3300042659 Bacteria 100300
16 Ga0466733_121115 3300042659 Bacteria 23017
17 Ga0466733_122410 3300042659 Bacteria 24342
18 Ga0415639_002683 3300038395 Bacteria 7355
19 Ga0123355_10000768 3300009826 Bacteria 43811
20 Ga0123355_10002311 3300009826 Bacteria 26915
21 Ga0123355_10059945 3300009826 Bacteria 6146
22 Ga0123356_10501565 3300010049 Bacteria 1370
23 Ga0123353_10000541 3300010167 Bacteria 46731
24 Ga0123353_10947754 3300010167 Bacteria 1165
25 Ga0466706_016581 3300042599 Bacteria 15320
26 Ga0466714_059477 3300042603 Bacteria 5462
27 Ga0466722_022255 3300042609 Bacteria 1467
28 Ga0466697_231512 3300042611 Unclassified 1696
29 Ga0123355_10000538 3300009826 Bacteria 50830
30 Ga0123355_10003928 3300009826 Bacteria 21514
31 Ga0123355_10005797 3300009826 Bacteria 18163
32 Ga0123355_10040933 3300009826 Bacteria 7543
33 Ga0123355_10055076 3300009826 Unclassified 6440
34 Ga0123355_10080276 3300009826 Bacteria 5209
35 Ga0123355_10081130 3300009826 Bacteria 5177
36 Ga0123355_10257274 3300009826 Bacteria 2447
37 Ga0123355_10316159 3300009826 Bacteria 2110
38 Ga0123356_10167333 3300010049 Unclassified 2204
39 Ga0466725_296803 3300042654 Bacteria 3251
40 Ga0466706_144389 3300042599 Bacteria 1343
41 IMNBL1DRAFT_c0024153 3300000062 Bacteria 2363
42 Ga0415639_002661 3300038395 Bacteria 37416
43 Ga0123355_10000512 3300009826 Bacteria 51673
44 Ga0123355_10008743 3300009826 Unclassified 15318
45 Ga0123355_10039891 3300009826 Bacteria 7643
46 Ga0123355_10065511 3300009826 Bacteria 5851
47 Ga0123355_10671832 3300009826 Bacteria 1201
48 Ga0123355_10726981 3300009826 Bacteria 1130
49 Ga0123354_10659997 3300010882 Unclassified 744
50 Ga0466725_311939 3300042654 Unclassified 4191
51 Ga0466721_386968 3300042608 Bacteria 1011
52 IMNBL1DRAFT_c0004436 3300000062 Bacteria 8450
53 JGI24695J34938_10014872 3300002450 Bacteria 4012
54 Ga0466697_217145 3300042611 Bacteria 1640
55 Ga0415639_018163 3300038395 Bacteria 10811
56 Ga0415639_053577 3300038395 Bacteria 2897
57 Ga0415639_130662 3300038395 Bacteria 2701
58 Ga0123355_10003187 3300009826 Bacteria 23434
59 Ga0123355_10004996 3300009826 Bacteria 19308
60 Ga0123355_10046336 3300009826 Bacteria 7071
61 Ga0123355_10096434 3300009826 Bacteria 4671
62 Ga0123355_10218658 3300009826 Bacteria 2745
63 Ga0123355_10388551 3300009826 Bacteria 1811
64 Ga0123355_10696243 3300009826 Unclassified 1168
65 Ga0123355_10719332 3300009826 Bacteria 1140
66 Ga0466706_110811 3300042599 Bacteria 3835
67 Ga0466700_110106 3300042600 Bacteria 9930
68 Ga0466697_012873 3300042611 Bacteria 4073
69 Ga0415639_058794 3300038395 Bacteria 7798
70 Ga0123355_10000058 3300009826 Bacteria 116421
71 Ga0123355_10021208 3300009826 Bacteria 10397
72 Ga0123355_10067170 3300009826 Bacteria 5771
73 Ga0123355_10474369 3300009826 Bacteria 1561
74 Ga0123355_10642738 3300009826 Bacteria 1241
75 Ga0466710_087298 3300042613 Bacteria 1182
76 Ga0466706_067064 3300042599 Bacteria 15154
77 Ga0466733_064030 3300042659 Bacteria 8090
78 Ga0466656_188407 3300042550 Bacteria 1745
79 Ga0466693_233963 3300042592 Bacteria 3306
80 Ga0123355_10004166 3300009826 Bacteria 20995
81 Ga0123355_10010827 3300009826 Bacteria 14022
82 Ga0123355_10015102 3300009826 Unclassified 12119
83 Ga0123355_10019000 3300009826 Bacteria 10931
84 Ga0123355_10095562 3300009826 Bacteria 4696
85 Ga0123355_10104206 3300009826 Bacteria 4455
86 Ga0123355_10139769 3300009826 Bacteria 3709
87 Ga0123355_10313156 3300009826 Bacteria 2124
88 Ga0123355_10523249 3300009826 Bacteria 1450
89 Ga0123355_10737346 3300009826 Bacteria 1119
90 Ga0123353_10249103 3300010167 Bacteria 2753
91 Ga0123354_10018968 3300010882 Bacteria 10800
92 Ga0466725_009555 3300042654 Bacteria 1098
93 Ga0466725_145353 3300042654 Bacteria 10132
94 Ga0466697_000256 3300042611 Bacteria 4695
95 IMNBL1DRAFT_c0020620 3300000062 Bacteria 2662
96 Ga0466657_092146 3300042582 Bacteria 4686
97 Ga0123355_10003137 3300009826 Bacteria 23609
98 Ga0123355_10006786 3300009826 Bacteria 17038
99 Ga0123355_10308725 3300009826 Bacteria 2147
100 Ga0123355_10322153 3300009826 Bacteria 2081
101 Ga0123355_10385963 3300009826 Bacteria 1820
102 Ga0123355_10712574 3300009826 Unclassified 1148
103 Ga0123353_10099554 3300010167 Bacteria 4685
104 Ga0123353_10180686 3300010167 Unclassified 3340
105 Ga0123353_10416556 3300010167 Bacteria 1992
106 Ga0123353_10837986 3300010167 Bacteria 1263
107 Ga0466706_240897 3300042599 Bacteria 31414
108 IMNBL1DRAFT_c0005264 3300000062 Unclassified 7460

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01966 HD HD domain 75 172 0.8

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.