Protein Family IF00658

Metagenome Isolate
206 Members
88 Samples
153 Scaffolds
475.34 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10013754|JGI24695J34938_100137542
Length
522 aa
Sequence
MKWEIVIGLEVHAELSTKSKIFCGCAAAYGGEPNTHVCPVCSGMPGALPVLNREVVEYALRLGLTLDCSITRHCKFDRKNYFYPDLPKAYQVSQLYAPICRDGYVEIESQLSSRSLDEGSSLDMNGSKKKIRIREIHMEEDAGKLNHTAQGSLMDFNRCGVPLLEIVSHPDFVNTSAANAAAEVTAYLEKLRETLLYLDICDCKMQEGSMRADINLSVRKPGEEFGVRTETKNMNSFKAIARAIEYEVNRQIDILEDGRQIIQETRRWDDDKGTSSGMRSKENAQDYRYFPEPDLLPLHIDDEWIARTRKNLPELAHQKRGRYARDYKISADEAGVLTCHKNISGLFETLARKTAAANPACAVNTAVESAHLVSGEIMRLMNSAYILPENLYIDENRGLAAASDQDGCKYIDTDKLAVLIGFVTSGKINRASYKETVEAVFTSNADPESYIAEKGLMMVSDDKAVTAAVEKIIDANKSSVEDYRAGKEKIFGFLMGMAMKELGKGGNPELVKKVLLEKLSK*

📊 Sample Types

Isolate 25.7%
Metagenome 74.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 59.8%
Termitidae 32.2%
Kalotermitidae 3.4%
Passalidae 2.3%
Hodotermitidae 1.1%
Rhinotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 201
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
4 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
14 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
15 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
16 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
17 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
18 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
23 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
24 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
25 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
26 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
27 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
30 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
31 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
32 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
33 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
38 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
39 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
40 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
41 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
42 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
52 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
53 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
54 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
55 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
56 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
57 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
58 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
61 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
62 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
63 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
64 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
65 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
66 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
67 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
68 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
69 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
70 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
71 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
72 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
73 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
74 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
75 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
76 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
77 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
78 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
79 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
80 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
81 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
82 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
83 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
84 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
85 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
86 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
87 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
88 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_165726 3300042611 Bacteria 8552
2 Ga0466732_031643 3300042656 Bacteria 29390
3 Ga0123355_10000057 3300009826 Bacteria 117095
4 Ga0123356_10001385 3300010049 Bacteria 26877
5 Ga0466720_071539 3300042607 Bacteria 31117
6 Ga0466720_166164 3300042607 Bacteria 10488
7 Ga0466718_170211 3300042617 Unclassified 6690
8 Ga0466693_036225 3300042592 Bacteria 1468
9 Ga0466694_035705 3300042594 Bacteria 8828
10 Ga0466699_050079 3300042597 Bacteria 5510
11 Ga0466699_241776 3300042597 Bacteria 4681
12 JGI24695J34938_10000281 3300002450 Bacteria 50109
13 JGI24695J34938_10001601 3300002450 Bacteria 19041
14 JGI24695J34938_10016924 3300002450 Bacteria 3691
15 Ga0123357_10002227 3300009784 Bacteria 21409
16 Ga0466702_143441 3300042635 Bacteria 1922
17 Ga0123356_10004359 3300010049 Bacteria 14631
18 Ga0123356_10035568 3300010049 Bacteria 4653
19 Ga0466706_199086 3300042599 Bacteria 3614
20 Ga0466720_058251 3300042607 Bacteria 15810
21 Ga0466720_074072 3300042607 Bacteria 10573
22 Ga0466721_203430 3300042608 Bacteria 11689
23 Ga0466718_077206 3300042617 Bacteria 2574
24 Ga0466699_313594 3300042597 Bacteria 1650
25 JGI24695J34938_10048454 3300002450 Unclassified 1871
26 JGI24702J35022_10002067 3300002462 Bacteria 12377
27 Ga0466702_044612 3300042635 Bacteria 9777
28 Ga0123355_10114390 3300009826 Bacteria 4206
29 Ga0123355_10117587 3300009826 Bacteria 4133
30 Ga0123356_10000455 3300010049 Bacteria 45828
31 Ga0123356_10002873 3300010049 Bacteria 18236
32 Ga0123356_10006143 3300010049 Bacteria 12182
33 Ga0123356_10047428 3300010049 Bacteria 3998
34 Ga0466700_088624 3300042600 Bacteria 14035
35 Ga0466720_043786 3300042607 Bacteria 10844
36 Ga0466720_088979 3300042607 Bacteria 10757
37 Ga0466720_166857 3300042607 Bacteria 7252
38 Ga0466718_015159 3300042617 Bacteria 8776
39 Ga0466718_075123 3300042617 Bacteria 21718
40 Ga0466694_020450 3300042594 Bacteria 6580
41 Ga0466699_055591 3300042597 Bacteria 1835
42 JGI24695J34938_10001200 3300002450 Bacteria 22953
43 JGI24695J34938_10001277 3300002450 Bacteria 22081
44 JGI24695J34938_10001529 3300002450 Bacteria 19517
45 JGI24695J34938_10007469 3300002450 Bacteria 6394
46 JGI24695J34938_10012432 3300002450 Bacteria 4510
47 JGI24695J34938_10013754 3300002450 Bacteria 4235
48 JGI24695J34938_10015699 3300002450 Bacteria 3877
49 JGI24695J34938_10019718 3300002450 Bacteria 3333
50 JGI24695J34938_10030842 3300002450 Bacteria 2493
51 JGI24702J35022_10001199 3300002462 Bacteria 16117
52 Ga0123357_10088796 3300009784 Bacteria 4038
53 Ga0123355_10247128 3300009826 Bacteria 2518
54 Ga0123356_10000245 3300010049 Bacteria 62546
55 Ga0123356_10106270 3300010049 Bacteria 2703
56 Ga0123353_10152485 3300010167 Bacteria 3688
57 Ga0466713_098236 3300042602 Bacteria 111747
58 Ga0466719_201025 3300042606 Bacteria 8565
59 Ga0466720_023578 3300042607 Bacteria 1877
60 Ga0466720_069558 3300042607 Bacteria 12664
61 Ga0466698_359324 3300042610 Bacteria 1936
62 Ga0466718_060235 3300042617 Bacteria 10966
63 Ga0466693_176187 3300042592 Unclassified 4719
64 Ga0466693_431211 3300042592 Bacteria 7389
65 Ga0466699_026869 3300042597 Bacteria 7996
66 Ga0466699_048865 3300042597 Bacteria 10938
67 2227200254 2225789004 Bacteria 7766
68 JGI24695J34938_10000054 3300002450 Bacteria 90526
69 JGI24695J34938_10013538 3300002450 Bacteria 4278
70 Ga0466697_248780 3300042611 Bacteria 2163
71 Ga0466705_233690 3300042612 Bacteria 3948
72 Ga0123356_10114825 3300010049 Bacteria 2608
73 Ga0123353_10000237 3300010167 Bacteria 69845
74 Ga0123353_10009097 3300010167 Bacteria 13656
75 Ga0123354_10035032 3300010882 Bacteria 7841
76 Ga0466706_108218 3300042599 Bacteria 67960
77 Ga0466717_240568 3300042604 Bacteria 2488
78 Ga0466720_094435 3300042607 Bacteria 70325
79 Ga0466718_141833 3300042617 Bacteria 2646
80 Ga0466718_161612 3300042617 Bacteria 3019
81 Ga0466729_046736 3300042621 Bacteria 36013
82 Ga0466693_218162 3300042592 Bacteria 2424
83 Ga0466693_346175 3300042592 Bacteria 19042
84 Ga0466699_052658 3300042597 Bacteria 21880
85 IMNBL1DRAFT_c0001754 3300000062 Bacteria 15896
86 AustNasuHG_c1003540 3300000089 Bacteria 5639
87 JGI24695J34938_10001810 3300002450 Bacteria 17521
88 JGI24695J34938_10015568 3300002450 Unclassified 3898
89 JGI24695J34938_10023454 3300002450 Bacteria 2975
90 JGI24705J35276_12225916 3300002504 Bacteria 2783
91 Ga0466732_306322 3300042656 Bacteria 1666
92 Ga0123356_10003015 3300010049 Bacteria 17787
93 Ga0123353_10002527 3300010167 Bacteria 22736
94 Ga0123353_10127039 3300010167 Bacteria 4097
95 Ga0466720_015681 3300042607 Bacteria 8120
96 Ga0466720_023183 3300042607 Bacteria 1792
97 Ga0466720_069510 3300042607 Bacteria 2579
98 Ga0466720_195145 3300042607 Bacteria 14789
99 Ga0466712_190629 3300042614 Bacteria 4679
100 Ga0466718_002379 3300042617 Bacteria 7377
101 Ga0466718_130079 3300042617 Bacteria 12884
102 Ga0466699_017614 3300042597 Bacteria 28515
103 Ga0466699_073124 3300042597 Bacteria 7807
104 Ga0466699_086653 3300042597 Bacteria 2278
105 AustNasuHG_c1000670 3300000089 Bacteria 12161
106 JGI24695J34938_10000369 3300002450 Bacteria 44536
107 JGI24695J34938_10030739 3300002450 Bacteria 2498
108 JGI24702J35022_10012000 3300002462 Bacteria 4824
109 Ga0466731_047577 3300042622 Bacteria 2009
110 Ga0466731_111511 3300042622 Bacteria 1631
111 Ga0466731_123559 3300042622 Bacteria 4590
112 Ga0466702_070425 3300042635 Bacteria 43516
113 Ga0123355_10051840 3300009826 Bacteria 6658
114 Ga0123356_10026214 3300010049 Bacteria 5477
115 Ga0123353_10456347 3300010167 Bacteria 1880
116 Ga0123353_10530716 3300010167 Bacteria 1704
117 Ga0466720_019748 3300042607 Bacteria 14933
118 Ga0466698_426345 3300042610 Bacteria 36274
119 Ga0466718_026629 3300042617 Bacteria 5236
120 Ga0466718_050371 3300042617 Bacteria 63846
121 Ga0466718_091158 3300042617 Bacteria 6420
122 Ga0466718_168986 3300042617 Bacteria 4235
123 Ga0466699_051861 3300042597 Bacteria 28735
124 Ga0466699_053949 3300042597 Bacteria 1792
125 AustNasuHG_c1000001 3300000089 Bacteria 78376
126 JGI24695J34938_10000110 3300002450 Bacteria 73179
127 JGI24695J34938_10000206 3300002450 Bacteria 55951
128 JGI24695J34938_10001063 3300002450 Bacteria 24879
129 JGI24695J34938_10002638 3300002450 Bacteria 13412
130 JGI24702J35022_10009486 3300002462 Bacteria 5461
131 JGI24703J35330_11748858 3300002501 Bacteria 56968
132 JGI24700J35501_10927819 3300002508 Bacteria 7097
133 Ga0074263_118637 3300005485 Bacteria 3205
134 Ga0466703_325441 3300042636 Bacteria 2690
135 Ga0123355_10029251 3300009826 Bacteria 8916
136 Ga0123355_10183591 3300009826 Bacteria 3099
137 Ga0123355_10325803 3300009826 Unclassified 2064
138 Ga0123356_10046433 3300010049 Bacteria 4041
139 Ga0123356_10062665 3300010049 Bacteria 3474
140 Ga0466720_050894 3300042607 Bacteria 11486
141 Ga0466720_104572 3300042607 Bacteria 12996
142 Ga0466698_306263 3300042610 Bacteria 5448
143 Ga0466718_014005 3300042617 Bacteria 4086
144 Ga0466718_038647 3300042617 Bacteria 3798
145 Ga0415639_130079 3300038395 Bacteria 3385
146 Ga0466694_111592 3300042594 Bacteria 3349
147 AustNasuHG_c1000392 3300000089 Bacteria 15204
148 JGI24698J34947_10064056 3300002449 Bacteria 1799
149 JGI24695J34938_10001089 3300002450 Bacteria 24545
150 JGI24695J34938_10004585 3300002450 Bacteria 8999
151 JGI24695J34938_10034731 3300002450 Bacteria 2311
152 Ga0105524_101619 3300007733 Bacteria 16194
153 Ga0466702_380098 3300042635 Bacteria 4656

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02934 GatB_N GatB/GatE catalytic domain 5 305 0.95
PF02637 GatB_Yqey GatB domain 411 519 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02934 GO:0016874 ligase activity MF
PF02637 GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.