Protein Family IF00614

Metagenome Metatranscriptome Isolate
252 Members
55 Samples
228 Scaffolds
141.75 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10002881|JGI24695J34938_1000288115
Length
161 aa
Sequence
MKRVYVNEKWCLGCHLCEYYCAFAGTNEKDMARALKDIKIRPKINIEEKDGVSFAVSCRHCNEPLCVKGCITGALTISNGVITINHDRCVSCYTCILSCPYGAVSPSEDGAVEKCELCVKTHANGSASADSSINADGSAGEAAPACVKGCPNGAIVFEER*

📊 Sample Types

Isolate 9.5%
Metagenome 89.7%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 48.1%
Termitidae 30.8%
Kalotermitidae 11.5%
Passalidae 3.8%
Rhinotermitidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 70

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
2 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
3 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
4 2772190998 Unclassified Bathyarchaeota Nc150P4bin1 Isolate Unclassified
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
13 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
14 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
19 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
20 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
21 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
22 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
23 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
24 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
25 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
36 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
37 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
38 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
39 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
45 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
46 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
53 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
54 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
55 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_366154 3300042656 Unclassified 3874
2 Ga0466712_044858 3300042614 Bacteria 8137
3 Ga0466712_062962 3300042614 Bacteria 14517
4 Ga0466712_081169 3300042614 Bacteria 7292
5 Ga0466712_099663 3300042614 Bacteria 4989
6 Ga0466712_166194 3300042614 Bacteria 8685
7 Ga0466712_188744 3300042614 Bacteria 1189
8 Ga0466712_197101 3300042614 Bacteria 7323
9 Ga0466712_205981 3300042614 Bacteria 13235
10 Ga0466711_095464 3300042615 Bacteria 4171
11 Ga0466718_017980 3300042617 Bacteria 6169
12 Ga0466718_058231 3300042617 Bacteria 1467
13 Ga0466702_416297 3300042635 Unclassified 1196
14 Ga0223677_1015196 3300021239 Bacteria 1567
15 Ga0255786_1025156 3300022815 Unclassified 1003
16 Ga0466699_160306 3300042597 Bacteria 14939
17 Ga0466699_398226 3300042597 Unclassified 1256
18 Ga0466706_037216 3300042599 Bacteria 21328
19 Ga0466719_178980 3300042606 Bacteria 12558
20 Ga0466720_125167 3300042607 Bacteria 3119
21 Ga0466720_128683 3300042607 Bacteria 6871
22 Ga0466720_203833 3300042607 Bacteria 1658
23 IMNBL1DRAFT_c0000032 3300000062 Bacteria 125696
24 JGI24698J34947_10008463 3300002449 Bacteria 5649
25 JGI24698J34947_10014484 3300002449 Bacteria 4295
26 JGI24698J34947_10029396 3300002449 Bacteria 2903
27 JGI24698J34947_10082748 3300002449 Unclassified 1500
28 JGI24695J34938_10000172 3300002450 Bacteria 60289
29 JGI24695J34938_10004073 3300002450 Bacteria 9765
30 JGI24695J34938_10036106 3300002450 Bacteria 2255
31 JGI24699J35502_11064739 3300002509 Unclassified 1777
32 Ga0072941_1059881 3300005201 Bacteria 4663
33 Ga0074263_112825 3300005485 Unclassified 1520
34 Ga0466712_057302 3300042614 Bacteria 15850
35 Ga0466712_070479 3300042614 Bacteria 1459
36 Ga0466718_008694 3300042617 Bacteria 28445
37 Ga0466718_164454 3300042617 Bacteria 10078
38 Ga0466702_007041 3300042635 Unclassified 1371
39 Ga0466702_197264 3300042635 Bacteria 3125
40 Ga0466702_328439 3300042635 Unclassified 1134
41 Ga0466702_367136 3300042635 Bacteria 1248
42 Ga0466704_293576 3300042643 Bacteria 26121
43 Ga0466699_037416 3300042597 Bacteria 1889
44 Ga0466699_053236 3300042597 Bacteria 4630
45 Ga0466699_117148 3300042597 Bacteria 2500
46 Ga0466707_212307 3300042601 Bacteria 4936
47 Ga0466720_173221 3300042607 Unclassified 1685
48 Ga0466698_029699 3300042610 Bacteria 18817
49 Ga0466698_243282 3300042610 Unclassified 1558
50 Ga0466698_385828 3300042610 Bacteria 1440
51 AustNasuHG_c1000056 3300000089 Bacteria 29882
52 AustNasuHG_c1005661 3300000089 Bacteria 4472
53 JGI24698J34947_10005050 3300002449 Bacteria 7230
54 JGI24698J34947_10005183 3300002449 Bacteria 7150
55 JGI24698J34947_10005280 3300002449 Bacteria 7086
56 JGI24698J34947_10048498 3300002449 Unclassified 2150
57 JGI24698J34947_10083695 3300002449 Unclassified 1488
58 JGI24698J34947_10095414 3300002449 Unclassified 1352
59 JGI24698J34947_10155753 3300002449 Unclassified 942
60 JGI24695J34938_10000290 3300002450 Unclassified 49669
61 JGI24695J34938_10001902 3300002450 Bacteria 16888
62 JGI24695J34938_10007001 3300002450 Bacteria 6684
63 JGI24695J34938_10007249 3300002450 Bacteria 6530
64 Ga0072940_1000304 3300005200 Bacteria 17618
65 Ga0072941_1000934 3300005201 Bacteria 43296
66 Ga0072941_1069124 3300005201 Unclassified 2172
67 Ga0466712_072533 3300042614 Bacteria 1075
68 Ga0466712_089893 3300042614 Bacteria 4669
69 Ga0466712_127920 3300042614 Bacteria 13180
70 Ga0466712_137133 3300042614 Bacteria 9447
71 Ga0466712_288720 3300042614 Bacteria 16832
72 Ga0466718_141417 3300042617 Bacteria 1777
73 Ga0466702_026383 3300042635 Bacteria 1377
74 Ga0466702_278850 3300042635 Unclassified 1037
75 Ga0466693_324905 3300042592 Bacteria 11159
76 Ga0466699_023357 3300042597 Unclassified 1379
77 Ga0466699_023726 3300042597 Unclassified 2076
78 Ga0466699_076324 3300042597 Bacteria 7092
79 Ga0466699_165209 3300042597 Bacteria 74941
80 Ga0466699_347123 3300042597 Unclassified 1785
81 Ga0466699_360526 3300042597 Bacteria 1839
82 Ga0466699_418118 3300042597 Bacteria 6186
83 Ga0466699_428403 3300042597 Bacteria 1481
84 AustNasuHG_c1007414 3300000089 Bacteria 3909
85 JGI24698J34947_10001674 3300002449 Bacteria 11831
86 JGI24698J34947_10003354 3300002449 Bacteria 8694
87 JGI24698J34947_10005239 3300002449 Bacteria 7117
88 JGI24698J34947_10009974 3300002449 Bacteria 5205
89 JGI24698J34947_10016483 3300002449 Unclassified 4011
90 JGI24698J34947_10037082 3300002449 Unclassified 2535
91 JGI24698J34947_10258100 3300002449 Unclassified 647
92 JGI24695J34938_10000738 3300002450 Bacteria 30754
93 JGI24695J34938_10015223 3300002450 Bacteria 3952
94 JGI24695J34938_10059728 3300002450 Bacteria 1629
95 Ga0072941_1007769 3300005201 Bacteria 9565
96 Ga0072941_1116219 3300005201 Unclassified 2699
97 Ga0072941_1135479 3300005201 Bacteria 6313
98 Ga0074263_107282 3300005485 Unclassified 1410
99 Ga0466712_054915 3300042614 Bacteria 81067
100 Ga0466712_194210 3300042614 Unclassified 1826
101 Ga0466718_022103 3300042617 Unclassified 1462
102 Ga0466718_050873 3300042617 Bacteria 3407
103 Ga0466718_078287 3300042617 Bacteria 19522
104 Ga0466702_003303 3300042635 Bacteria 1826
105 Ga0466702_168211 3300042635 Bacteria 6442
106 Ga0264413_104306 3300024493 Bacteria 15415
107 Ga0466693_157512 3300042592 Bacteria 1374
108 Ga0466693_178774 3300042592 Bacteria 22741
109 Ga0466699_012102 3300042597 Bacteria 16549
110 Ga0466699_274499 3300042597 Unclassified 1391
111 Ga0466699_419813 3300042597 Bacteria 3037
112 Ga0466706_020497 3300042599 Bacteria 75707
113 Ga0466707_098379 3300042601 Bacteria 1164
114 Ga0466722_047069 3300042609 Bacteria 2249
115 Ga0466698_036908 3300042610 Unclassified 1054
116 2227319684 2225789004 Bacteria 6418
117 AustNasuHG_c1022899 3300000089 Bacteria 2001
118 JGI24698J34947_10001547 3300002449 Bacteria 12173
119 JGI24698J34947_10009828 3300002449 Unclassified 5246
120 JGI24698J34947_10012729 3300002449 Unclassified 4606
121 JGI24698J34947_10049934 3300002449 Bacteria 2111
122 JGI24698J34947_10058866 3300002449 Unclassified 1901
123 JGI24698J34947_10145260 3300002449 Unclassified 993
124 JGI24695J34938_10002538 3300002450 Bacteria 13803
125 Ga0072940_1316313 3300005200 Unclassified 2508
126 Ga0466732_127367 3300042656 Bacteria 10479
127 Ga0466705_503964 3300042612 Bacteria 24703
128 Ga0466729_175954 3300042621 Bacteria 7396
129 Ga0466702_247230 3300042635 Bacteria 1295
130 Ga0466702_357583 3300042635 Bacteria 1698
131 Ga0466720_012731 3300042607 Bacteria 38091
132 Ga0466720_116740 3300042607 Bacteria 72912
133 Ga0466720_121956 3300042607 Bacteria 8223
134 Ga0466698_478431 3300042610 Bacteria 1093
135 Ga0466698_481553 3300042610 Unclassified 1408
136 JGI24698J34947_10000212 3300002449 Bacteria 23884
137 JGI24698J34947_10007276 3300002449 Bacteria 6080
138 JGI24698J34947_10008013 3300002449 Bacteria 5799
139 JGI24698J34947_10010353 3300002449 Unclassified 5113
140 JGI24698J34947_10015658 3300002449 Bacteria 4126
141 JGI24698J34947_10035056 3300002449 Bacteria 2622
142 JGI24698J34947_10066206 3300002449 Unclassified 1758
143 JGI24698J34947_10113370 3300002449 Unclassified 1192
144 JGI24698J34947_10124293 3300002449 Unclassified 1114
145 JGI24695J34938_10005279 3300002450 Bacteria 8119
146 JGI24695J34938_10005890 3300002450 Unclassified 7523
147 JGI24695J34938_10016280 3300002450 Bacteria 3787
148 JGI24695J34938_10275058 3300002450 Unclassified 721
149 JGI24699J35502_10851472 3300002509 Unclassified 956
150 Ga0072940_1030118 3300005200 Bacteria 5842
151 Ga0072941_1090269 3300005201 Bacteria 5681
152 Ga0074263_105575 3300005485 Unclassified 1311
153 Ga0074263_117392 3300005485 Bacteria 2703
154 Ga0466712_017999 3300042614 Bacteria 4900
155 Ga0466712_035991 3300042614 Unclassified 1184
156 Ga0466712_052372 3300042614 Bacteria 14538
157 Ga0466712_074908 3300042614 Bacteria 23470
158 Ga0466712_089358 3300042614 Bacteria 5112
159 Ga0466718_050586 3300042617 Bacteria 10484
160 Ga0466699_011741 3300042597 Unclassified 2644
161 Ga0466699_278973 3300042597 Unclassified 1009
162 Ga0466720_003590 3300042607 Bacteria 8287
163 Ga0466720_012213 3300042607 Unclassified 1390
164 Ga0466720_085977 3300042607 Bacteria 8276
165 Ga0466720_171114 3300042607 Bacteria 5328
166 JGI24698J34947_10016296 3300002449 Bacteria 4034
167 JGI24698J34947_10018466 3300002449 Bacteria 3766
168 JGI24698J34947_10093392 3300002449 Unclassified 1374
169 JGI24695J34938_10000258 3300002450 Bacteria 51430
170 JGI24695J34938_10001047 3300002450 Bacteria 25078
171 JGI24695J34938_10016403 3300002450 Bacteria 3766
172 JGI24695J34938_10032779 3300002450 Bacteria 2397
173 JGI24695J34938_10055598 3300002450 Bacteria 1710
174 Ga0072941_1018844 3300005201 Unclassified 6965
175 Ga0466732_351702 3300042656 Bacteria 2171
176 Ga0466705_448898 3300042612 Bacteria 2048
177 Ga0466712_021182 3300042614 Bacteria 18924
178 Ga0466712_107739 3300042614 Bacteria 8818
179 Ga0466711_168651 3300042615 Bacteria 11969
180 Ga0466702_220717 3300042635 Unclassified 1061
181 Ga0264413_116636 3300024493 Bacteria 9308
182 Ga0466693_097979 3300042592 Unclassified 1270
183 Ga0466699_002401 3300042597 Bacteria 74503
184 Ga0466699_028592 3300042597 Bacteria 12643
185 Ga0466699_091410 3300042597 Unclassified 1834
186 Ga0466699_158523 3300042597 Bacteria 1638
187 Ga0466699_175963 3300042597 Unclassified 2003
188 Ga0466699_214219 3300042597 Bacteria 1239
189 Ga0466720_120938 3300042607 Bacteria 1233
190 Ga0466720_231477 3300042607 Bacteria 2064
191 AustNasuHG_c1010392 3300000089 Bacteria 3244
192 AustNasuHG_c1013117 3300000089 Bacteria 2848
193 JGI24698J34947_10003097 3300002449 Bacteria 9009
194 JGI24698J34947_10027499 3300002449 Unclassified 3017
195 JGI24698J34947_10087312 3300002449 Unclassified 1442
196 JGI24698J34947_10130057 3300002449 Unclassified 1078
197 JGI24698J34947_10265279 3300002449 Unclassified 634
198 JGI24695J34938_10000656 3300002450 Bacteria 32803
199 JGI24695J34938_10027859 3300002450 Unclassified 2665
200 JGI24695J34938_10036295 3300002450 Unclassified 2248
201 JGI24695J34938_10041737 3300002450 Unclassified 2058
202 Ga0466732_248529 3300042656 Unclassified 2988
203 Ga0466705_501922 3300042612 Bacteria 4542
204 Ga0466712_033366 3300042614 Bacteria 28713
205 Ga0466712_139530 3300042614 Bacteria 5205
206 Ga0466712_159787 3300042614 Bacteria 7131
207 Ga0466718_154793 3300042617 Bacteria 5337
208 Ga0466723_235592 3300042618 Bacteria 1446
209 Ga0466696_010141 3300042596 Bacteria 4767
210 Ga0466699_046596 3300042597 Unclassified 1593
211 Ga0466699_080265 3300042597 Bacteria 20894
212 Ga0466699_131531 3300042597 Bacteria 20480
213 Ga0466699_217891 3300042597 Unclassified 1233
214 Ga0466699_259633 3300042597 Unclassified 1092
215 Ga0466720_072170 3300042607 Bacteria 36693
216 Ga0466720_112162 3300042607 Bacteria 1836
217 2227084994 2225789004 Unclassified 1861
218 AustNasuHG_c1000121 3300000089 Bacteria 23751
219 AustNasuHG_c1001742 3300000089 Bacteria 7867
220 JGI24698J34947_10001299 3300002449 Bacteria 13103
221 JGI24698J34947_10012464 3300002449 Bacteria 4660
222 JGI24698J34947_10044122 3300002449 Unclassified 2284
223 JGI24698J34947_10064304 3300002449 Unclassified 1793
224 JGI24695J34938_10001863 3300002450 Bacteria 17144
225 JGI24695J34938_10002881 3300002450 Bacteria 12532
226 JGI24695J34938_10048890 3300002450 Bacteria 1861
227 JGI24695J34938_10225993 3300002450 Unclassified 787
228 JGI24697J35500_11076574 3300002507 Unclassified 1099

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12837 Fer4_6 4Fe-4S binding domain 81 103 0.95
PF12838 Fer4_7 4Fe-4S dicluster domain 57 103 0.95
PF00037 Fer4 4Fe-4S binding domain 82 104 0.94
PF13187 Fer4_9 4Fe-4S dicluster domain 58 103 0.93
PF13247 Fer4_11 4Fe-4S dicluster domain 54 132 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.