Protein Family IF00569
Metagenome
Isolate
463
Members
296
Samples
263
Scaffolds
130.62
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10174988|JGI24698J34947_101749882
- Length
- 133 aa
- Sequence
- MAMSDPIADMLTRIRNAQMAEKTAVSMPASKLKAAIAAVLKAEGYVEDFAVKPLPGNKATLEIALKYYAGRPVIERIERVSKPGLRIYKGFEDIPRVMNGLGIAIVSTPKGVMTDRSARASRVGGEVLCLVA*
Sample Types
Isolate
43.0%
Metagenome
57.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.7%
Apidae
23.2%
Unclassified
10.0%
Termitidae
9.7%
Formicidae
5.9%
Kalotermitidae
4.8%
Elmidae
4.2%
Culicidae
2.8%
Rhinotermitidae
1.4%
Armadillidiidae
1.4%
Termopsidae
1.4%
Drosophilidae
1.0%
Curculionidae
1.0%
Hydrophilidae
0.7%
Passalidae
0.7%
Berytidae
0.7%
Largidae
0.7%
Aphididae
0.7%
Alydidae
0.7%
Aleyrodidae
0.3%
Hodotermitidae
0.3%
Crambidae
0.3%
Cicadellidae
0.3%
Taxonomy
Archaea
0
Bacteria
429
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 3 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 4 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 5 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 6 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 7 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 10 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 11 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 14 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 24 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 25 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 26 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 27 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 28 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 29 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 30 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 31 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 32 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 33 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 34 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 35 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 36 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 37 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 44 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 45 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 46 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 47 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 48 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 49 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 50 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 51 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 52 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 53 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 54 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 55 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 56 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 57 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 58 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 59 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 60 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 61 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 62 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 63 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 64 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 65 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 66 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 67 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 68 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 69 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 70 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 74 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 75 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 76 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 77 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 78 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 79 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 80 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 81 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 82 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 83 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 84 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 85 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 86 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 87 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 88 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 89 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 90 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 91 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 92 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 93 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 94 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 95 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 96 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 97 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 98 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 99 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 100 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 105 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 106 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 107 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 108 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 109 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 110 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 111 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 112 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 113 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 114 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 115 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 116 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 117 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 118 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 119 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 120 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 121 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 122 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 123 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 124 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 125 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 126 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 127 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 128 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 129 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 130 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 131 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 132 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 133 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 134 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 135 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 136 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 137 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 138 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 139 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 140 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 141 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 142 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 143 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 144 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 145 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 146 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 147 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 148 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 149 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 150 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 151 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 152 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 153 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 154 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 155 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 156 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 157 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 158 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 159 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 160 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 161 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 162 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 163 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 164 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 165 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 166 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 167 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 168 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 169 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 170 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 171 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 172 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 173 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 174 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 175 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 176 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 177 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 178 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 179 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 180 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 181 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 182 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 183 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 184 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 185 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 186 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 187 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 188 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 189 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 190 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 191 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 192 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 193 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 194 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 195 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 196 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 197 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 198 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 199 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 200 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 201 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 202 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 203 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 204 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 205 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 206 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 207 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 208 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 209 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 210 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 211 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 212 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 213 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 214 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 215 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 216 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 217 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 218 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 219 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 220 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 221 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 222 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 223 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 224 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 225 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 226 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 227 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 228 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 229 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 230 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 231 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 232 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 233 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 234 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 235 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 236 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 237 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 238 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 239 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 240 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 241 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 242 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 243 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 244 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 245 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 246 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 247 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 248 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 249 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 250 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 251 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 252 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 253 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 254 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 255 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 256 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 257 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 258 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 259 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 260 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 261 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 262 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 263 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 264 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 265 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 266 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 267 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 268 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 269 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 270 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 271 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 272 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 273 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 274 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 275 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 276 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 277 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 278 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 279 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 280 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 281 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 282 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 283 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 284 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 285 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 286 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 287 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 288 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 289 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 290 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 291 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 292 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 293 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 294 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 295 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 296 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160468_100431 | 3300012819 | Bacteria | 17464 |
| 2 | Ga0160446_103994 | 3300012835 | Bacteria | 2246 |
| 3 | Ga0466657_051167 | 3300042582 | Bacteria | 10371 |
| 4 | Ga0466657_322606 | 3300042582 | Bacteria | 9653 |
| 5 | Ga0466690_149138 | 3300042590 | Bacteria | 14715 |
| 6 | Ga0466690_289774 | 3300042590 | Bacteria | 3568 |
| 7 | Ga0466690_321140 | 3300042590 | Bacteria | 25918 |
| 8 | Ga0466701_001027 | 3300042598 | Bacteria | 90142 |
| 9 | Ga0466701_007757 | 3300042598 | Bacteria | 1584 |
| 10 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 11 | Ga0466710_115345 | 3300042613 | Bacteria | 8153 |
| 12 | Ga0466729_051623 | 3300042621 | Unclassified | 2596 |
| 13 | Ga0466729_084932 | 3300042621 | Bacteria | 104590 |
| 14 | Ga0123357_10219977 | 3300009784 | Unclassified | 2109 |
| 15 | Ga0123353_10008266 | 3300010167 | Bacteria | 14186 |
| 16 | Ga0123354_10026109 | 3300010882 | Bacteria | 9212 |
| 17 | JGI24705J35276_12235518 | 3300002504 | Bacteria | 6624 |
| 18 | CVPL010W_10047849 | 3300002931 | Bacteria | 1985 |
| 19 | CVPL010W_10047879 | 3300002931 | Bacteria | 1081 |
| 20 | Ga0072941_1141096 | 3300005201 | Bacteria | 10652 |
| 21 | Ga0074278_113864 | 3300005721 | Unclassified | 6249 |
| 22 | Ga0103263_102686 | 3300007042 | Bacteria | 2182 |
| 23 | Ga0102738_1012445 | 3300007141 | Unclassified | 1173 |
| 24 | Ga0103268_1001471 | 3300007192 | Unclassified | 5814 |
| 25 | Ga0466734_005435 | 3300042623 | Bacteria | 6040 |
| 26 | Ga0466734_029869 | 3300042623 | Bacteria | 3214 |
| 27 | Ga0466734_030009 | 3300042623 | Unclassified | 1693 |
| 28 | Ga0466704_405583 | 3300042643 | Bacteria | 15459 |
| 29 | Ga0466724_33621 | 3300042649 | Bacteria | 1874 |
| 30 | Ga0466725_164280 | 3300042654 | Bacteria | 17642 |
| 31 | Ga0466725_185939 | 3300042654 | Bacteria | 36509 |
| 32 | Ga0466701_023502 | 3300042598 | Bacteria | 2880 |
| 33 | Ga0466701_027731 | 3300042598 | Bacteria | 5643 |
| 34 | Ga0466701_092611 | 3300042598 | Bacteria | 2656 |
| 35 | Ga0466707_175120 | 3300042601 | Bacteria | 20435 |
| 36 | Ga0466707_258979 | 3300042601 | Bacteria | 7487 |
| 37 | Ga0466717_282689 | 3300042604 | Unclassified | 3781 |
| 38 | Ga0466719_486350 | 3300042606 | Bacteria | 13185 |
| 39 | Ga0466722_202204 | 3300042609 | Bacteria | 5956 |
| 40 | Ga0466697_099832 | 3300042611 | Bacteria | 2564 |
| 41 | Ga0466733_059229 | 3300042659 | Bacteria | 36946 |
| 42 | Ga0160434_110046 | 3300012850 | Unclassified | 1538 |
| 43 | Ga0466657_102684 | 3300042582 | Bacteria | 1777 |
| 44 | Ga0466657_289121 | 3300042582 | Bacteria | 1073 |
| 45 | Ga0466692_193948 | 3300042591 | Bacteria | 9758 |
| 46 | Ga0466715_030743 | 3300042616 | Bacteria | 4935 |
| 47 | Ga0466726_067584 | 3300042619 | Bacteria | 4925 |
| 48 | Ga0123357_10018066 | 3300009784 | Bacteria | 9365 |
| 49 | Ga0123353_10056133 | 3300010167 | Unclassified | 6303 |
| 50 | 2227640999 | 2225789004 | Bacteria | 2061 |
| 51 | JGI24702J35022_10074246 | 3300002462 | Bacteria | 1835 |
| 52 | CVPL010W_10005074 | 3300002931 | Bacteria | 14271 |
| 53 | CVPL005W_1000015 | 3300002934 | Bacteria | 63243 |
| 54 | CVPL005W_1001807 | 3300002934 | Unclassified | 6782 |
| 55 | Ga0068302_10000086 | 3300005071 | Bacteria | 8701 |
| 56 | Ga0103266_1000065 | 3300007067 | Bacteria | 42217 |
| 57 | Ga0103265_1000457 | 3300007068 | Unclassified | 6945 |
| 58 | Ga0102740_1000547 | 3300007140 | Bacteria | 10288 |
| 59 | Ga0103264_1000587 | 3300007188 | Bacteria | 23529 |
| 60 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 61 | Ga0123357_10001915 | 3300009784 | Bacteria | 22651 |
| 62 | Ga0466730_091386 | 3300042625 | Bacteria | 123631 |
| 63 | Ga0466702_420939 | 3300042635 | Bacteria | 6684 |
| 64 | Ga0466727_137609 | 3300042655 | Bacteria | 15927 |
| 65 | Ga0466701_057745 | 3300042598 | Bacteria | 2351 |
| 66 | Ga0466717_222936 | 3300042604 | Bacteria | 2706 |
| 67 | Ga0466716_170437 | 3300042605 | Bacteria | 1147 |
| 68 | Ga0466657_092930 | 3300042582 | Bacteria | 2052 |
| 69 | Ga0466657_141958 | 3300042582 | Bacteria | 2300 |
| 70 | Ga0466692_058899 | 3300042591 | Bacteria | 20827 |
| 71 | Ga0466691_209335 | 3300042593 | Bacteria | 25069 |
| 72 | Ga0466710_048207 | 3300042613 | Bacteria | 5505 |
| 73 | Ga0466711_145003 | 3300042615 | Bacteria | 32111 |
| 74 | Ga0466728_179152 | 3300042620 | Bacteria | 4284 |
| 75 | Ga0466729_165527 | 3300042621 | Bacteria | 3812 |
| 76 | Ga0123355_10975168 | 3300009826 | Bacteria | 905 |
| 77 | 2227531529 | 2225789004 | Bacteria | 631 |
| 78 | WW0001_100130 | 3300002732 | Bacteria | 100882 |
| 79 | CVPL010W_10003429 | 3300002931 | Bacteria | 18525 |
| 80 | Ga0103261_1056411 | 3300007083 | Bacteria | 581 |
| 81 | Ga0103264_1000318 | 3300007188 | Bacteria | 26213 |
| 82 | Ga0103264_1010575 | 3300007188 | Bacteria | 4505 |
| 83 | Ga0103267_1000117 | 3300007190 | Bacteria | 30369 |
| 84 | Ga0103268_1000009 | 3300007192 | Bacteria | 66076 |
| 85 | Ga0466734_015756 | 3300042623 | Bacteria | 28187 |
| 86 | Ga0466709_317533 | 3300042648 | Bacteria | 2747 |
| 87 | Ga0466724_03072 | 3300042649 | Bacteria | 18268 |
| 88 | Ga0466708_117775 | 3300042652 | Bacteria | 15479 |
| 89 | Ga0466725_461929 | 3300042654 | Bacteria | 22391 |
| 90 | Ga0466701_022393 | 3300042598 | Bacteria | 1555 |
| 91 | Ga0466706_043778 | 3300042599 | Bacteria | 1714 |
| 92 | Ga0466706_086700 | 3300042599 | Bacteria | 1228 |
| 93 | Ga0466706_199859 | 3300042599 | Bacteria | 9363 |
| 94 | Ga0466713_091546 | 3300042602 | Bacteria | 18477 |
| 95 | Ga0466713_109624 | 3300042602 | Bacteria | 13785 |
| 96 | Ga0466717_222166 | 3300042604 | Bacteria | 3124 |
| 97 | Ga0466719_157184 | 3300042606 | Bacteria | 16488 |
| 98 | Ga0466697_178025 | 3300042611 | Bacteria | 8041 |
| 99 | Ga0466732_077377 | 3300042656 | Bacteria | 3461 |
| 100 | Ga0160472_109309 | 3300012839 | Bacteria | 1272 |
| 101 | Ga0160448_131466 | 3300012854 | Unclassified | 765 |
| 102 | Ga0160457_1030941 | 3300012858 | Unclassified | 736 |
| 103 | Ga0466656_367615 | 3300042550 | Unclassified | 1087 |
| 104 | Ga0466692_184437 | 3300042591 | Bacteria | 20938 |
| 105 | Ga0466705_389907 | 3300042612 | Bacteria | 51380 |
| 106 | Ga0466710_326977 | 3300042613 | Bacteria | 2065 |
| 107 | Ga0466711_247281 | 3300042615 | Bacteria | 5801 |
| 108 | Ga0466715_193807 | 3300042616 | Bacteria | 17352 |
| 109 | Ga0466715_600618 | 3300042616 | Bacteria | 1225 |
| 110 | Ga0466723_124011 | 3300042618 | Bacteria | 17539 |
| 111 | Ga0123356_10910814 | 3300010049 | Unclassified | 1050 |
| 112 | Ga0123353_11403631 | 3300010167 | Unclassified | 898 |
| 113 | JGI24702J35022_10009928 | 3300002462 | Bacteria | 5335 |
| 114 | JGI24705J35276_11664867 | 3300002504 | Bacteria | 617 |
| 115 | CVPL010W_10004005 | 3300002931 | Bacteria | 16640 |
| 116 | Ga0103266_1000200 | 3300007067 | Bacteria | 16981 |
| 117 | Ga0103261_1000695 | 3300007083 | Unclassified | 9466 |
| 118 | Ga0102734_1048291 | 3300007129 | Bacteria | 1889 |
| 119 | Ga0103260_1018340 | 3300007139 | Unclassified | 995 |
| 120 | Ga0102737_1009356 | 3300007142 | Unclassified | 1690 |
| 121 | Ga0103264_1000188 | 3300007188 | Bacteria | 52510 |
| 122 | Ga0466735_172843 | 3300042624 | Bacteria | 3929 |
| 123 | Ga0466703_120689 | 3300042636 | Bacteria | 1640 |
| 124 | Ga0466708_088956 | 3300042652 | Bacteria | 13799 |
| 125 | Ga0466708_308504 | 3300042652 | Bacteria | 17035 |
| 126 | Ga0466708_431611 | 3300042652 | Bacteria | 17147 |
| 127 | Ga0466725_146840 | 3300042654 | Bacteria | 3520 |
| 128 | Ga0466725_399048 | 3300042654 | Bacteria | 14201 |
| 129 | Ga0466706_231592 | 3300042599 | Bacteria | 4461 |
| 130 | Ga0466700_386178 | 3300042600 | Bacteria | 3495 |
| 131 | Ga0466719_047699 | 3300042606 | Bacteria | 11168 |
| 132 | Ga0466719_079825 | 3300042606 | Bacteria | 11953 |
| 133 | Ga0466722_141657 | 3300042609 | Bacteria | 8529 |
| 134 | Ga0160431_100175 | 3300012828 | Bacteria | 44721 |
| 135 | Ga0160459_100048 | 3300012831 | Bacteria | 189455 |
| 136 | Ga0160472_105816 | 3300012839 | Bacteria | 1923 |
| 137 | Ga0160447_139456 | 3300012849 | Bacteria | 550 |
| 138 | Ga0466657_021707 | 3300042582 | Bacteria | 36648 |
| 139 | Ga0466693_401868 | 3300042592 | Bacteria | 4950 |
| 140 | Ga0466691_077504 | 3300042593 | Bacteria | 2153 |
| 141 | Ga0466691_106582 | 3300042593 | Bacteria | 7070 |
| 142 | Ga0466696_110075 | 3300042596 | Bacteria | 5185 |
| 143 | Ga0466710_042268 | 3300042613 | Unclassified | 5941 |
| 144 | Ga0466711_063795 | 3300042615 | Bacteria | 5388 |
| 145 | Ga0466715_438666 | 3300042616 | Bacteria | 23685 |
| 146 | Ga0466723_020620 | 3300042618 | Bacteria | 11703 |
| 147 | Ga0466726_047171 | 3300042619 | Bacteria | 2325 |
| 148 | Ga0466726_079457 | 3300042619 | Bacteria | 4157 |
| 149 | Ga0466728_181251 | 3300042620 | Bacteria | 18833 |
| 150 | Ga0123357_10775879 | 3300009784 | Unclassified | 657 |
| 151 | Ga0123354_10116493 | 3300010882 | Bacteria | 3484 |
| 152 | CVPL005L_10064580 | 3300002938 | Unclassified | 571 |
| 153 | Ga0074278_108389 | 3300005721 | Bacteria | 25110 |
| 154 | Ga0103263_100138 | 3300007042 | Unclassified | 12577 |
| 155 | Ga0102740_1015922 | 3300007140 | Bacteria | 1153 |
| 156 | Ga0102737_1000494 | 3300007142 | Bacteria | 12852 |
| 157 | Ga0103264_1000132 | 3300007188 | Bacteria | 42832 |
| 158 | Ga0103264_1000276 | 3300007188 | Bacteria | 50783 |
| 159 | Ga0105005_1025813 | 3300007505 | Bacteria | 3530 |
| 160 | Ga0466703_060848 | 3300042636 | Bacteria | 8939 |
| 161 | Ga0466703_320420 | 3300042636 | Bacteria | 23900 |
| 162 | Ga0466704_195288 | 3300042643 | Bacteria | 25757 |
| 163 | Ga0466725_040109 | 3300042654 | Bacteria | 1681 |
| 164 | Ga0466725_087681 | 3300042654 | Bacteria | 5011 |
| 165 | Ga0466701_053737 | 3300042598 | Bacteria | 3550 |
| 166 | Ga0160441_100021 | 3300012825 | Bacteria | 266877 |
| 167 | Ga0160447_103001 | 3300012849 | Bacteria | 5607 |
| 168 | Ga0466657_266463 | 3300042582 | Bacteria | 2865 |
| 169 | Ga0466690_406175 | 3300042590 | Bacteria | 69346 |
| 170 | Ga0466710_114811 | 3300042613 | Bacteria | 1189 |
| 171 | Ga0466726_188842 | 3300042619 | Bacteria | 15083 |
| 172 | Ga0160471_106584 | 3300012812 | Bacteria | 1448 |
| 173 | JGI24702J35022_10008095 | 3300002462 | Bacteria | 5983 |
| 174 | CVPL005L_10015189 | 3300002938 | Bacteria | 5016 |
| 175 | Ga0102736_1004360 | 3300007052 | Unclassified | 1909 |
| 176 | Ga0104044_1001803 | 3300007136 | Bacteria | 937 |
| 177 | Ga0104044_1151516 | 3300007136 | Bacteria | 962 |
| 178 | Ga0103264_1000443 | 3300007188 | Bacteria | 21903 |
| 179 | Ga0466734_029421 | 3300042623 | Bacteria | 26553 |
| 180 | Ga0466704_473875 | 3300042643 | Bacteria | 7315 |
| 181 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 182 | Ga0466708_215602 | 3300042652 | Bacteria | 15739 |
| 183 | Ga0466725_003364 | 3300042654 | Bacteria | 4081 |
| 184 | Ga0466725_017039 | 3300042654 | Bacteria | 50096 |
| 185 | Ga0466725_255049 | 3300042654 | Bacteria | 1193 |
| 186 | Ga0466727_335351 | 3300042655 | Bacteria | 67580 |
| 187 | Ga0466701_095383 | 3300042598 | Bacteria | 5672 |
| 188 | Ga0466714_165404 | 3300042603 | Bacteria | 1984 |
| 189 | Ga0466717_271615 | 3300042604 | Bacteria | 2851 |
| 190 | Ga0466719_055618 | 3300042606 | Bacteria | 10384 |
| 191 | Ga0466719_185726 | 3300042606 | Bacteria | 1768 |
| 192 | Ga0466722_136888 | 3300042609 | Bacteria | 17058 |
| 193 | Ga0466697_256944 | 3300042611 | Bacteria | 3243 |
| 194 | Ga0466705_069381 | 3300042612 | Unclassified | 7318 |
| 195 | Ga0160468_105537 | 3300012819 | Bacteria | 1427 |
| 196 | Ga0160444_121507 | 3300012841 | Bacteria | 703 |
| 197 | Ga0160436_1030667 | 3300012861 | Unclassified | 919 |
| 198 | Ga0466657_370470 | 3300042582 | Bacteria | 1417 |
| 199 | Ga0466692_128697 | 3300042591 | Bacteria | 29218 |
| 200 | Ga0466696_042576 | 3300042596 | Bacteria | 13410 |
| 201 | Ga0466710_211598 | 3300042613 | Bacteria | 14971 |
| 202 | Ga0466723_233813 | 3300042618 | Bacteria | 18111 |
| 203 | Ga0123356_10955046 | 3300010049 | Unclassified | 1028 |
| 204 | Ga0136159_1000014 | 3300010217 | Bacteria | 131100 |
| 205 | Ga0123354_10002414 | 3300010882 | Bacteria | 24635 |
| 206 | Ga0160471_100449 | 3300012812 | Bacteria | 11696 |
| 207 | JGI24695J34938_10059858 | 3300002450 | Bacteria | 1627 |
| 208 | Ga0068305_10277852 | 3300005083 | Bacteria | 15502 |
| 209 | Ga0072941_1125686 | 3300005201 | Bacteria | 4666 |
| 210 | Ga0102736_1000277 | 3300007052 | Bacteria | 11410 |
| 211 | Ga0102739_1000381 | 3300007095 | Bacteria | 9630 |
| 212 | Ga0102734_1011377 | 3300007129 | Bacteria | 3259 |
| 213 | Ga0102734_1013932 | 3300007129 | Bacteria | 1929 |
| 214 | Ga0103264_1013761 | 3300007188 | Bacteria | 3973 |
| 215 | Ga0466734_085482 | 3300042623 | Bacteria | 4977 |
| 216 | Ga0466735_162129 | 3300042624 | Unclassified | 1302 |
| 217 | Ga0466703_276609 | 3300042636 | Bacteria | 60964 |
| 218 | Ga0466704_501270 | 3300042643 | Bacteria | 6076 |
| 219 | Ga0466725_128862 | 3300042654 | Unclassified | 4263 |
| 220 | Ga0466701_066530 | 3300042598 | Bacteria | 6962 |
| 221 | Ga0466701_083530 | 3300042598 | Bacteria | 21770 |
| 222 | Ga0466707_398396 | 3300042601 | Bacteria | 9298 |
| 223 | Ga0466717_091910 | 3300042604 | Bacteria | 9410 |
| 224 | Ga0466719_395400 | 3300042606 | Bacteria | 1494 |
| 225 | Ga0160433_124908 | 3300012846 | Bacteria | 691 |
| 226 | Ga0160430_126389 | 3300012852 | Unclassified | 750 |
| 227 | Ga0466657_155583 | 3300042582 | Bacteria | 6161 |
| 228 | Ga0466691_156291 | 3300042593 | Bacteria | 26465 |
| 229 | Ga0466695_078306 | 3300042595 | Bacteria | 5706 |
| 230 | Ga0466710_275977 | 3300042613 | Bacteria | 1239 |
| 231 | Ga0466712_182347 | 3300042614 | Bacteria | 11394 |
| 232 | Ga0466711_109307 | 3300042615 | Bacteria | 29995 |
| 233 | Ga0466715_109155 | 3300042616 | Bacteria | 3627 |
| 234 | Ga0466715_140159 | 3300042616 | Bacteria | 9478 |
| 235 | Ga0466715_269641 | 3300042616 | Bacteria | 3729 |
| 236 | Ga0466718_119762 | 3300042617 | Bacteria | 1975 |
| 237 | Ga0466726_052963 | 3300042619 | Bacteria | 1588 |
| 238 | Ga0123356_12484237 | 3300010049 | Unclassified | 648 |
| 239 | Ga0160464_100135 | 3300012805 | Bacteria | 81696 |
| 240 | IMNBGM34_c000442 | 3300000036 | Bacteria | 11282 |
| 241 | SCG598O11_10834 | 3300000471 | Bacteria | 5470 |
| 242 | JGI24698J34947_10174988 | 3300002449 | Bacteria | 864 |
| 243 | JGI24705J35276_12221426 | 3300002504 | Bacteria | 2340 |
| 244 | CVPL010W_10006354 | 3300002931 | Bacteria | 21839 |
| 245 | Ga0103263_116178 | 3300007042 | Unclassified | 726 |
| 246 | Ga0102738_1002383 | 3300007141 | Bacteria | 2809 |
| 247 | Ga0104048_1168521 | 3300007143 | Bacteria | 4147 |
| 248 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 249 | Ga0103268_1053559 | 3300007192 | Unclassified | 997 |
| 250 | Ga0127649_131930 | 3300009460 | Unclassified | 3100 |
| 251 | Ga0123357_10000387 | 3300009784 | Bacteria | 41806 |
| 252 | Ga0466734_128421 | 3300042623 | Bacteria | 1979 |
| 253 | Ga0466703_072305 | 3300042636 | Bacteria | 2375 |
| 254 | Ga0466703_087786 | 3300042636 | Bacteria | 1618 |
| 255 | Ga0466724_05566 | 3300042649 | Bacteria | 1231 |
| 256 | Ga0466708_032942 | 3300042652 | Bacteria | 36683 |
| 257 | Ga0466725_049736 | 3300042654 | Bacteria | 2193 |
| 258 | Ga0466725_272788 | 3300042654 | Bacteria | 15338 |
| 259 | Ga0466717_058368 | 3300042604 | Bacteria | 4391 |
| 260 | Ga0466716_288795 | 3300042605 | Bacteria | 12220 |
| 261 | Ga0466719_142224 | 3300042606 | Bacteria | 4621 |
| 262 | Ga0466722_155417 | 3300042609 | Bacteria | 2209 |
| 263 | Ga0466722_196355 | 3300042609 | Bacteria | 12120 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00410 | Ribosomal_S8 | Ribosomal protein S8 | 5 | 131 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.