Protein Family IF00554

Metagenome Isolate
109 Members
41 Samples
107 Scaffolds
93.2 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10088906|JGI24698J34947_100889062
Length
96 aa
Sequence
MMCMTFEWDERKNQENIKKHHVSFEKAQEAFFDNDRIIIKDKKHSKKEERFFCVGNDGNGIVTVRFTIRKNIRILGAGYWREGRYKYEQKKRNLH*

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.5%
Kalotermitidae 22.5%
Unclassified 10.0%
Termopsidae 5.0%
Rhinotermitidae 5.0%

🌳 Taxonomy

Archaea 0
Bacteria 100
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
7 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
12 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
13 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
38 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_189132 3300042601 Bacteria 18291
2 Ga0466717_287177 3300042604 Bacteria 1362
3 JGI24698J34947_10026388 3300002449 Bacteria 3087
4 JGI24698J34947_10107125 3300002449 Bacteria 1241
5 JGI24698J34947_10112378 3300002449 Bacteria 1199
6 Ga0072940_1092649 3300005200 Bacteria 1024
7 Ga0466711_120077 3300042615 Bacteria 1019
8 Ga0466711_267760 3300042615 Bacteria 1019
9 Ga0466699_096279 3300042597 Bacteria 1405
10 Ga0466699_222089 3300042597 Bacteria 3099
11 Ga0466708_041044 3300042652 Bacteria 1757
12 Ga0466707_212737 3300042601 Bacteria 2194
13 Ga0466720_066790 3300042607 Unclassified 1586
14 JGI24698J34947_10019077 3300002449 Bacteria 3703
15 JGI24698J34947_10081853 3300002449 Unclassified 1512
16 JGI24698J34947_10146205 3300002449 Bacteria 988
17 JGI24699J35502_10655371 3300002509 Bacteria 726
18 Ga0068305_10065601 3300005083 Unclassified 2558
19 Ga0074263_104668 3300005485 Bacteria 4267
20 Ga0466705_403337 3300042612 Bacteria 1446
21 Ga0466712_129800 3300042614 Bacteria 7194
22 Ga0466728_129878 3300042620 Bacteria 1263
23 Ga0466728_310383 3300042620 Bacteria 1558
24 Ga0456237_0021366 3300041968 Bacteria 894
25 Ga0123356_11067583 3300010049 Bacteria 977
26 Ga0466702_232017 3300042635 Bacteria 1039
27 Ga0466703_278579 3300042636 Bacteria 1149
28 Ga0466705_340076 3300042612 Bacteria 2128
29 Ga0466707_243441 3300042601 Bacteria 1516
30 JGI24698J34947_10023893 3300002449 Bacteria 3267
31 JGI24702J35022_10080047 3300002462 Bacteria 1769
32 Ga0466705_398665 3300042612 Bacteria 1164
33 Ga0466712_093448 3300042614 Bacteria 1568
34 Ga0466712_199478 3300042614 Bacteria 2356
35 Ga0466712_223052 3300042614 Bacteria 2522
36 Ga0466726_385037 3300042619 Bacteria 1298
37 Ga0466726_467997 3300042619 Bacteria 1058
38 Ga0466699_026680 3300042597 Bacteria 3594
39 Ga0466732_359692 3300042656 Bacteria 1379
40 Ga0466707_307437 3300042601 Bacteria 1244
41 JGI24698J34947_10123636 3300002449 Unclassified 1118
42 Ga0466712_018664 3300042614 Bacteria 4783
43 Ga0466712_255395 3300042614 Bacteria 1965
44 Ga0466703_037669 3300042636 Bacteria 4963
45 Ga0466719_259522 3300042606 Bacteria 4867
46 Ga0466722_165381 3300042609 Bacteria 2561
47 JGI24698J34947_10019046 3300002449 Bacteria 3706
48 JGI24698J34947_10219807 3300002449 Bacteria 729
49 JGI24698J34947_10250405 3300002449 Bacteria 662
50 Ga0466712_000594 3300042614 Bacteria 29291
51 Ga0466726_436088 3300042619 Bacteria 1311
52 Ga0456237_0054423 3300041968 Bacteria 519
53 Ga0466699_011772 3300042597 Bacteria 1347
54 Ga0466699_436077 3300042597 Bacteria 1434
55 Ga0123356_11057072 3300010049 Bacteria 981
56 Ga0123354_10076648 3300010882 Unclassified 4770
57 Ga0466719_132074 3300042606 Bacteria 11828
58 AustNasuHG_c1023396 3300000089 Bacteria 1973
59 JGI24698J34947_10000092 3300002449 Bacteria 30066
60 JGI24698J34947_10015661 3300002449 Bacteria 4126
61 JGI24695J34938_10013181 3300002450 Bacteria 4350
62 Ga0466712_067902 3300042614 Bacteria 10860
63 Ga0466715_133234 3300042616 Unclassified 7025
64 Ga0466701_013847 3300042598 Bacteria 1184
65 Ga0123356_10001332 3300010049 Bacteria 27284
66 Ga0123356_12245963 3300010049 Bacteria 682
67 Ga0466704_370569 3300042643 Bacteria 5701
68 Ga0466709_405792 3300042648 Bacteria 2870
69 Ga0466727_097762 3300042655 Bacteria 1161
70 Ga0466705_144146 3300042612 Bacteria 9164
71 FAAS_10213899 3300001880 Bacteria 566
72 JGI24698J34947_10022980 3300002449 Bacteria 3338
73 JGI24698J34947_10023934 3300002449 Bacteria 3264
74 JGI24698J34947_10106107 3300002449 Bacteria 1250
75 JGI24698J34947_10129073 3300002449 Bacteria 1084
76 JGI24698J34947_10317754 3300002449 Unclassified 555
77 JGI24702J35022_10039428 3300002462 Bacteria 2520
78 Ga0466711_053821 3300042615 Bacteria 1773
79 Ga0466728_009824 3300042620 Bacteria 11275
80 Ga0456237_0038243 3300041968 Bacteria 635
81 Ga0466695_028829 3300042595 Bacteria 1096
82 Ga0466695_270771 3300042595 Bacteria 5043
83 Ga0466699_020427 3300042597 Bacteria 1116
84 Ga0466699_080484 3300042597 Bacteria 1494
85 Ga0123355_10002576 3300009826 Bacteria 25712
86 Ga0123356_10464543 3300010049 Bacteria 1416
87 Ga0123356_11438763 3300010049 Bacteria 849
88 Ga0466702_216885 3300042635 Bacteria 1371
89 Ga0466704_313970 3300042643 Unclassified 1688
90 Ga0466727_256011 3300042655 Bacteria 1101
91 Ga0466707_358758 3300042601 Bacteria 1404
92 Ga0466707_411757 3300042601 Bacteria 1259
93 JGI24698J34947_10088906 3300002449 Bacteria 1424
94 JGI24698J34947_10186147 3300002449 Bacteria 825
95 JGI24697J35500_11242058 3300002507 Bacteria 2260
96 Ga0466705_505580 3300042612 Bacteria 16842
97 Ga0466712_062435 3300042614 Unclassified 4492
98 Ga0466726_073426 3300042619 Bacteria 2782
99 Ga0466656_370731 3300042550 Bacteria 1262
100 Ga0466699_050614 3300042597 Bacteria 1886
101 Ga0123357_10654413 3300009784 Bacteria 776
102 Ga0123356_10256901 3300010049 Bacteria 1828
103 Ga0466731_385651 3300042622 Bacteria 1212
104 Ga0466734_099886 3300042623 Bacteria 1207
105 Ga0466708_046156 3300042652 Bacteria 35995
106 Ga0466708_341269 3300042652 Bacteria 1176
107 Ga0466727_346997 3300042655 Bacteria 1728

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042607 Ga0466720_066790 Ga0466720_066790_1067_1339 90
2 3300000089 AustNasuHG_c1023396 AustNasuHG_10233961 91
3 3300001880 FAAS_10213899 FAAS_102138992 91
4 3300002449 JGI24698J34947_10106107 JGI24698J34947_101061072 91
5 3300005485 Ga0074263_104668 Ga0074263_1046682 91
6 3300010049 Ga0123356_10001332 Ga0123356_100013322 91
7 3300010049 Ga0123356_10256901 Ga0123356_102569014 91
8 3300010049 Ga0123356_11438763 Ga0123356_114387632 91
9 3300042652 Ga0466708_046156 Ga0466708_046156_973_1248 91
10 3300010049 Ga0123356_10464543 Ga0123356_104645433 92
11 3300041968 Ga0456237_0054423 Ga0456237_0054423_34_312 92
12 3300042595 Ga0466695_028829 Ga0466695_028829_396_674 92
13 3300042597 Ga0466699_026680 Ga0466699_026680_2874_3152 92
14 3300042598 Ga0466701_013847 Ga0466701_013847_361_639 92
15 3300042601 Ga0466707_189132 Ga0466707_189132_373_651 92
16 3300042601 Ga0466707_212737 Ga0466707_212737_421_699 92
17 3300042601 Ga0466707_243441 Ga0466707_243441_950_1228 92
18 3300042601 Ga0466707_307437 Ga0466707_307437_511_789 92
19 3300042601 Ga0466707_358758 Ga0466707_358758_852_1130 92
20 3300042601 Ga0466707_411757 Ga0466707_411757_610_888 92
21 3300042612 Ga0466705_144146 Ga0466705_144146_708_986 92
22 3300042612 Ga0466705_340076 Ga0466705_340076_1136_1414 92
23 3300042612 Ga0466705_398665 Ga0466705_398665_462_740 92
24 3300042612 Ga0466705_403337 Ga0466705_403337_304_582 92
25 3300042612 Ga0466705_505580 Ga0466705_505580_16403_16681 92
26 3300042615 Ga0466711_053821 Ga0466711_053821_446_724 92
27 3300042615 Ga0466711_267760 Ga0466711_267760_433_711 92
28 3300042619 Ga0466726_467997 Ga0466726_467997_563_841 92
29 3300042623 Ga0466734_099886 Ga0466734_099886_316_594 92
30 3300042635 Ga0466702_216885 Ga0466702_216885_128_406 92
31 3300042635 Ga0466702_232017 Ga0466702_232017_195_473 92
32 3300042636 Ga0466703_037669 Ga0466703_037669_1112_1390 92
33 3300042636 Ga0466703_278579 Ga0466703_278579_811_1089 92
34 3300042643 Ga0466704_313970 Ga0466704_313970_29_307 92
35 3300042643 Ga0466704_370569 Ga0466704_370569_3233_3511 92
36 3300042648 Ga0466709_405792 Ga0466709_405792_1828_2106 92
37 3300042655 Ga0466727_256011 Ga0466727_256011_634_912 92
38 3300042655 Ga0466727_346997 Ga0466727_346997_873_1151 92
39 3300002449 JGI24698J34947_10015661 JGI24698J34947_100156619 93
40 3300002462 JGI24702J35022_10039428 JGI24702J35022_100394284 93
41 3300005083 Ga0068305_10065601 Ga0068305_100656014 93
42 3300005200 Ga0072940_1092649 Ga0072940_10926492 93
43 3300041968 Ga0456237_0021366 Ga0456237_0021366_548_829 93
44 3300041968 Ga0456237_0038243 Ga0456237_0038243_275_556 93
45 3300042550 Ga0466656_370731 Ga0466656_370731_871_1152 93
46 3300042595 Ga0466695_270771 Ga0466695_270771_88_369 93
47 3300042597 Ga0466699_011772 Ga0466699_011772_977_1258 93
48 3300042597 Ga0466699_020427 Ga0466699_020427_337_618 93
49 3300042597 Ga0466699_050614 Ga0466699_050614_1376_1657 93
50 3300042597 Ga0466699_080484 Ga0466699_080484_852_1133 93
51 3300042597 Ga0466699_096279 Ga0466699_096279_301_582 93
52 3300042597 Ga0466699_222089 Ga0466699_222089_1532_1813 93
53 3300042597 Ga0466699_436077 Ga0466699_436077_728_1009 93
54 3300042604 Ga0466717_287177 Ga0466717_287177_509_790 93
55 3300042606 Ga0466719_132074 Ga0466719_132074_6266_6547 93
56 3300042606 Ga0466719_259522 Ga0466719_259522_3987_4268 93
57 3300042609 Ga0466722_165381 Ga0466722_165381_67_348 93
58 3300042614 Ga0466712_000594 Ga0466712_000594_24890_25171 93
59 3300042614 Ga0466712_018664 Ga0466712_018664_3125_3406 93
60 3300042614 Ga0466712_062435 Ga0466712_062435_3377_3658 93
61 3300042614 Ga0466712_067902 Ga0466712_067902_4180_4461 93
62 3300042614 Ga0466712_093448 Ga0466712_093448_734_1015 93
63 3300042614 Ga0466712_129800 Ga0466712_129800_3362_3643 93
64 3300042614 Ga0466712_199478 Ga0466712_199478_1853_2134 93
65 3300042614 Ga0466712_255395 Ga0466712_255395_752_1033 93
66 3300042615 Ga0466711_120077 Ga0466711_120077_377_658 93
67 3300042616 Ga0466715_133234 Ga0466715_133234_254_535 93
68 3300042619 Ga0466726_073426 Ga0466726_073426_1276_1557 93
69 3300042619 Ga0466726_385037 Ga0466726_385037_673_954 93
70 3300042619 Ga0466726_436088 Ga0466726_436088_206_487 93
71 3300042620 Ga0466728_009824 Ga0466728_009824_109_390 93
72 3300042620 Ga0466728_129878 Ga0466728_129878_141_422 93
73 3300042620 Ga0466728_310383 Ga0466728_310383_364_645 93
74 3300042622 Ga0466731_385651 Ga0466731_385651_501_782 93
75 3300042652 Ga0466708_041044 Ga0466708_041044_1180_1461 93
76 3300042652 Ga0466708_341269 Ga0466708_341269_855_1136 93
77 3300042655 Ga0466727_097762 Ga0466727_097762_550_831 93
78 3300042656 Ga0466732_359692 Ga0466732_359692_461_742 93
79 iso_pr_bacteria 2781125689 2781426309 93
80 3300002449 JGI24698J34947_10000092 JGI24698J34947_1000009215 94
81 3300002449 JGI24698J34947_10019046 JGI24698J34947_100190463 94
82 3300002449 JGI24698J34947_10019077 JGI24698J34947_100190773 94
83 3300002449 JGI24698J34947_10022980 JGI24698J34947_100229803 94
84 3300002449 JGI24698J34947_10023893 JGI24698J34947_100238936 94
85 3300002449 JGI24698J34947_10023934 JGI24698J34947_100239344 94
86 3300002449 JGI24698J34947_10026388 JGI24698J34947_100263883 94
87 3300002449 JGI24698J34947_10081853 JGI24698J34947_100818532 94
88 3300002449 JGI24698J34947_10107125 JGI24698J34947_101071252 94
89 3300002449 JGI24698J34947_10112378 JGI24698J34947_101123783 94
90 3300002449 JGI24698J34947_10123636 JGI24698J34947_101236361 94
91 3300002449 JGI24698J34947_10146205 JGI24698J34947_101462052 94
92 3300002449 JGI24698J34947_10186147 JGI24698J34947_101861471 94
93 3300002449 JGI24698J34947_10219807 JGI24698J34947_102198072 94
94 3300002449 JGI24698J34947_10250405 JGI24698J34947_102504051 94
95 3300002449 JGI24698J34947_10317754 JGI24698J34947_103177541 94
96 3300002450 JGI24695J34938_10013181 JGI24695J34938_100131815 94
97 3300002462 JGI24702J35022_10080047 JGI24702J35022_100800473 94
98 3300002507 JGI24697J35500_11242058 JGI24697J35500_112420584 94
99 3300002509 JGI24699J35502_10655371 JGI24699J35502_106553712 94
100 3300009784 Ga0123357_10654413 Ga0123357_106544132 94
101 3300010049 Ga0123356_11057072 Ga0123356_110570723 94
102 3300010049 Ga0123356_11067583 Ga0123356_110675832 94
103 3300010049 Ga0123356_12245963 Ga0123356_122459631 94
104 3300010882 Ga0123354_10076648 Ga0123354_100766487 94
105 3300002449 JGI24698J34947_10088906 JGI24698J34947_100889062 96
106 3300042614 Ga0466712_223052 Ga0466712_223052_896_1186 96
107 3300009826 Ga0123355_10002576 Ga0123355_100025763 101
108 iso_pr_bacteria 2819994798 2819997006 104
109 3300002449 JGI24698J34947_10129073 JGI24698J34947_101290733 113

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04365 BrnT_toxin Ribonuclease toxin, BrnT, of type II toxin-antitoxin system 8 81 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.