Protein Family IF00545
Metagenome
Isolate
169
Members
61
Samples
153
Scaffolds
274.15
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10060789|JGI24698J34947_100607892
- Length
- 309 aa
- Sequence
- MIERDDTYIRWAVYATLAAVTFITLFPFVWMLSSSLKHDSDIFSLPMRWIPRNPVWSNYTAFRQKIKFALFTFNSFKLSVIITLVQLVTSSFAAYGFAKCKFRGRDTLFFIYVAAIAIPWQTYMLPQYAELRMMGLTNSHLGYILLQSFTAFGVFLMRQFYVTIPNELLDAARIDGLTEYGNYFRIALPLSKPVTATLAIFVFVTIWNDFMGPMIYFDSEHIKTIPLGIRVFFTQYSTEYGLVMAASVVSLIPVFVIFLFFQRFFNVASGVTLIIRLPIPLLSAIIQSGEKNRHAACRTQCSHQGDKI*
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
25.9%
Termitidae
25.9%
Unclassified
12.1%
Blattidae
8.6%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Apidae
3.4%
Tenebrionidae
3.4%
Blaberidae
1.7%
Hodotermitidae
1.7%
Scarabaeidae
1.7%
Passalidae
1.7%
Culicidae
1.7%
Taxonomy
Archaea
0
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 2 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 12 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 13 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 14 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 15 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 16 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 28 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 44 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 47 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 48 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 49 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 54 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 55 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_032074 | 3300042659 | Bacteria | 1719 |
| 2 | Ga0466733_133318 | 3300042659 | Bacteria | 15442 |
| 3 | Ga0123356_10012277 | 3300010049 | Unclassified | 8321 |
| 4 | Ga0123356_10027168 | 3300010049 | Bacteria | 5366 |
| 5 | Ga0123354_10032338 | 3300010882 | Bacteria | 8198 |
| 6 | Ga0466714_030700 | 3300042603 | Bacteria | 1589 |
| 7 | Ga0466716_147045 | 3300042605 | Unclassified | 2799 |
| 8 | Ga0466719_532739 | 3300042606 | Bacteria | 2700 |
| 9 | Ga0466722_031201 | 3300042609 | Bacteria | 2095 |
| 10 | HBC_ctgsDRAFT_1005864 | 3300000333 | Bacteria | 2887 |
| 11 | Ga0466711_092928 | 3300042615 | Bacteria | 9679 |
| 12 | Ga0466728_160900 | 3300042620 | Bacteria | 3834 |
| 13 | Ga0466728_307027 | 3300042620 | Bacteria | 14270 |
| 14 | Ga0466692_091698 | 3300042591 | Bacteria | 2253 |
| 15 | Ga0466735_065117 | 3300042624 | Bacteria | 4563 |
| 16 | Ga0466703_071573 | 3300042636 | Bacteria | 38745 |
| 17 | Ga0466703_391345 | 3300042636 | Bacteria | 6934 |
| 18 | Ga0466709_025964 | 3300042648 | Unclassified | 2157 |
| 19 | Ga0466705_105181 | 3300042612 | Bacteria | 8113 |
| 20 | Ga0466705_270237 | 3300042612 | Unclassified | 1791 |
| 21 | Ga0466732_453003 | 3300042656 | Bacteria | 3432 |
| 22 | Ga0466733_184179 | 3300042659 | Bacteria | 1577 |
| 23 | Ga0466733_222674 | 3300042659 | Bacteria | 2475 |
| 24 | Ga0530661_000449 | 3300056564 | Bacteria | 30522 |
| 25 | Ga0530661_000813 | 3300056564 | Unclassified | 19726 |
| 26 | Ga0562375_0977 | 3300056856 | Bacteria | 45446 |
| 27 | Ga0466706_184912 | 3300042599 | Bacteria | 1274 |
| 28 | Ga0466714_068756 | 3300042603 | Bacteria | 2015 |
| 29 | JGI24705J35276_12195028 | 3300002504 | Bacteria | 1520 |
| 30 | Ga0466705_388055 | 3300042612 | Bacteria | 1324 |
| 31 | Ga0466715_234207 | 3300042616 | Bacteria | 6526 |
| 32 | Ga0466723_331036 | 3300042618 | Unclassified | 1454 |
| 33 | Ga0466735_118331 | 3300042624 | Bacteria | 6904 |
| 34 | Ga0466708_137768 | 3300042652 | Unclassified | 5441 |
| 35 | Ga0466727_186536 | 3300042655 | Bacteria | 1901 |
| 36 | Ga0466727_196888 | 3300042655 | Bacteria | 3744 |
| 37 | Ga0466733_200505 | 3300042659 | Bacteria | 1102 |
| 38 | Ga0123356_10013570 | 3300010049 | Bacteria | 7857 |
| 39 | Ga0123353_10271570 | 3300010167 | Bacteria | 2612 |
| 40 | Ga0466719_475628 | 3300042606 | Bacteria | 4214 |
| 41 | IMNBL1DRAFT_c0004070 | 3300000062 | Unclassified | 8965 |
| 42 | Ga0466712_248813 | 3300042614 | Bacteria | 1170 |
| 43 | Ga0466712_275299 | 3300042614 | Bacteria | 1832 |
| 44 | Ga0466715_102152 | 3300042616 | Bacteria | 26108 |
| 45 | Ga0466723_061885 | 3300042618 | Unclassified | 3157 |
| 46 | Ga0466726_363425 | 3300042619 | Bacteria | 1383 |
| 47 | Ga0456237_0005665 | 3300041968 | Bacteria | 1976 |
| 48 | Ga0466692_075362 | 3300042591 | Bacteria | 14936 |
| 49 | Ga0466696_415113 | 3300042596 | Unclassified | 1945 |
| 50 | Ga0466696_503139 | 3300042596 | Unclassified | 4177 |
| 51 | Ga0466735_028538 | 3300042624 | Bacteria | 1527 |
| 52 | Ga0466735_213268 | 3300042624 | Bacteria | 3092 |
| 53 | Ga0466703_016863 | 3300042636 | Bacteria | 21531 |
| 54 | Ga0466724_22891 | 3300042649 | Bacteria | 1334 |
| 55 | Ga0466708_362257 | 3300042652 | Bacteria | 1055 |
| 56 | Ga0123356_10131284 | 3300010049 | Bacteria | 2455 |
| 57 | Ga0466706_042960 | 3300042599 | Bacteria | 3433 |
| 58 | Ga0466722_116236 | 3300042609 | Bacteria | 14860 |
| 59 | Ga0466711_154115 | 3300042615 | Bacteria | 5780 |
| 60 | Ga0466715_075422 | 3300042616 | Bacteria | 6738 |
| 61 | Ga0466726_305952 | 3300042619 | Bacteria | 1367 |
| 62 | Ga0466729_106172 | 3300042621 | Bacteria | 1567 |
| 63 | Ga0160452_100554 | 3300012834 | Bacteria | 22191 |
| 64 | Ga0466690_205216 | 3300042590 | Bacteria | 8359 |
| 65 | Ga0466691_015732 | 3300042593 | Bacteria | 9938 |
| 66 | Ga0466691_114796 | 3300042593 | Bacteria | 4667 |
| 67 | Ga0466694_346552 | 3300042594 | Bacteria | 1785 |
| 68 | Ga0466703_147002 | 3300042636 | Bacteria | 25312 |
| 69 | Ga0466704_147514 | 3300042643 | Bacteria | 20598 |
| 70 | Ga0466704_228543 | 3300042643 | Bacteria | 21203 |
| 71 | Ga0466709_133655 | 3300042648 | Bacteria | 2383 |
| 72 | Ga0466708_326628 | 3300042652 | Unclassified | 1573 |
| 73 | Ga0466705_134609 | 3300042612 | Bacteria | 8078 |
| 74 | Ga0466733_150891 | 3300042659 | Bacteria | 9991 |
| 75 | Ga0123356_10000304 | 3300010049 | Bacteria | 56175 |
| 76 | Ga0466713_107250 | 3300042602 | Bacteria | 117772 |
| 77 | Ga0466719_465232 | 3300042606 | Unclassified | 1091 |
| 78 | Ga0466705_462592 | 3300042612 | Unclassified | 1187 |
| 79 | Ga0466726_076233 | 3300042619 | Bacteria | 8223 |
| 80 | Ga0466726_241465 | 3300042619 | Bacteria | 4024 |
| 81 | Ga0466728_064268 | 3300042620 | Bacteria | 2973 |
| 82 | Ga0466728_226439 | 3300042620 | Unclassified | 5301 |
| 83 | Ga0466690_422176 | 3300042590 | Bacteria | 6043 |
| 84 | Ga0466693_432228 | 3300042592 | Bacteria | 1950 |
| 85 | Ga0466696_406263 | 3300042596 | Bacteria | 4202 |
| 86 | Ga0466696_411312 | 3300042596 | Bacteria | 13470 |
| 87 | Ga0466703_021542 | 3300042636 | Bacteria | 1040 |
| 88 | Ga0466727_290855 | 3300042655 | Bacteria | 5027 |
| 89 | Ga0466705_043972 | 3300042612 | Bacteria | 3423 |
| 90 | Ga0466733_222539 | 3300042659 | Unclassified | 3356 |
| 91 | Ga0123356_10005295 | 3300010049 | Bacteria | 13153 |
| 92 | Ga0123356_10047898 | 3300010049 | Bacteria | 3977 |
| 93 | Ga0123353_10134081 | 3300010167 | Bacteria | 3973 |
| 94 | Ga0466722_024420 | 3300042609 | Bacteria | 11123 |
| 95 | Ga0466722_081764 | 3300042609 | Bacteria | 8287 |
| 96 | Ga0466715_047596 | 3300042616 | Bacteria | 5791 |
| 97 | Ga0466715_225080 | 3300042616 | Bacteria | 9556 |
| 98 | Ga0466715_434614 | 3300042616 | Bacteria | 1915 |
| 99 | Ga0466715_477821 | 3300042616 | Bacteria | 3493 |
| 100 | Ga0466729_117770 | 3300042621 | Bacteria | 1173 |
| 101 | Ga0160431_105765 | 3300012828 | Unclassified | 1991 |
| 102 | Ga0456237_0005553 | 3300041968 | Bacteria | 1995 |
| 103 | Ga0466692_116451 | 3300042591 | Bacteria | 68874 |
| 104 | Ga0466691_065493 | 3300042593 | Bacteria | 7635 |
| 105 | Ga0466696_210716 | 3300042596 | Bacteria | 2188 |
| 106 | Ga0466703_074381 | 3300042636 | Bacteria | 16111 |
| 107 | Ga0466704_118460 | 3300042643 | Bacteria | 7543 |
| 108 | Ga0466727_070007 | 3300042655 | Bacteria | 2053 |
| 109 | Ga0466727_165835 | 3300042655 | Bacteria | 2607 |
| 110 | Ga0466733_076724 | 3300042659 | Bacteria | 1112 |
| 111 | Ga0466733_122251 | 3300042659 | Bacteria | 10907 |
| 112 | Ga0466733_165415 | 3300042659 | Bacteria | 5240 |
| 113 | Ga0123355_10051880 | 3300009826 | Bacteria | 6656 |
| 114 | Ga0123356_10002573 | 3300010049 | Bacteria | 19337 |
| 115 | Ga0466719_070799 | 3300042606 | Bacteria | 2324 |
| 116 | Ga0072940_1398568 | 3300005200 | Bacteria | 1066 |
| 117 | Ga0466715_023258 | 3300042616 | Bacteria | 2152 |
| 118 | Ga0466715_056780 | 3300042616 | Bacteria | 5410 |
| 119 | Ga0466723_120733 | 3300042618 | Bacteria | 3605 |
| 120 | Ga0466723_138609 | 3300042618 | Bacteria | 5323 |
| 121 | Ga0466726_005842 | 3300042619 | Bacteria | 1324 |
| 122 | Ga0466728_251198 | 3300042620 | Unclassified | 2056 |
| 123 | Ga0160470_100152 | 3300012813 | Bacteria | 67604 |
| 124 | Ga0160452_100011 | 3300012834 | Bacteria | 394039 |
| 125 | Ga0466690_344946 | 3300042590 | Bacteria | 1498 |
| 126 | Ga0466691_211771 | 3300042593 | Bacteria | 5110 |
| 127 | Ga0466729_285866 | 3300042621 | Bacteria | 1690 |
| 128 | Ga0466704_210129 | 3300042643 | Bacteria | 5504 |
| 129 | Ga0466704_240554 | 3300042643 | Bacteria | 8645 |
| 130 | Ga0466709_101397 | 3300042648 | Unclassified | 7380 |
| 131 | Ga0466727_011012 | 3300042655 | Bacteria | 1429 |
| 132 | Ga0466727_161432 | 3300042655 | Bacteria | 1722 |
| 133 | Ga0466705_023505 | 3300042612 | Bacteria | 24705 |
| 134 | Ga0123356_10039206 | 3300010049 | Bacteria | 4414 |
| 135 | Ga0466716_058211 | 3300042605 | Bacteria | 4487 |
| 136 | Ga0466719_029559 | 3300042606 | Unclassified | 8928 |
| 137 | Ga0466722_063635 | 3300042609 | Bacteria | 5302 |
| 138 | Ga0466722_191004 | 3300042609 | Bacteria | 2768 |
| 139 | JGI24698J34947_10060789 | 3300002449 | Bacteria | 1862 |
| 140 | Ga0466711_379155 | 3300042615 | Bacteria | 21372 |
| 141 | Ga0466715_072859 | 3300042616 | Unclassified | 26805 |
| 142 | Ga0466723_026424 | 3300042618 | Bacteria | 20136 |
| 143 | Ga0466723_121908 | 3300042618 | Bacteria | 1604 |
| 144 | Ga0466726_397527 | 3300042619 | Bacteria | 1701 |
| 145 | Ga0160430_101198 | 3300012852 | Bacteria | 10285 |
| 146 | Ga0466690_082250 | 3300042590 | Unclassified | 4621 |
| 147 | Ga0466691_020423 | 3300042593 | Bacteria | 6122 |
| 148 | Ga0466694_129735 | 3300042594 | Bacteria | 12597 |
| 149 | Ga0466703_171311 | 3300042636 | Bacteria | 1924 |
| 150 | Ga0466704_284523 | 3300042643 | Bacteria | 6702 |
| 151 | Ga0466709_029337 | 3300042648 | Bacteria | 6835 |
| 152 | Ga0466727_196842 | 3300042655 | Bacteria | 2698 |
| 153 | Ga0466727_204209 | 3300042655 | Unclassified | 12483 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 90 | 265 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.