Protein Family IF00525

Metagenome Isolate
192 Members
71 Samples
186 Scaffolds
260.02 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10031812|JGI24698J34947_100318123
Length
287 aa
Sequence
VARPLSAVAYTETLREKTINLTCGGNIVSYWTDLSIDFANQRNYLDELFKIYPTTPDGIRDIDEDLWESIEKSFNNRNNVDLIAHLLRLDLFPLKDSYVAYLKRDPDAIQRNPNTINRLCGRLYDMGLDKIFERCSEPKETNRQIGPLFKRWLDNGGLGIKPVKIDDFQKNEENAILDASDTAMKSWCADHLYYVRDKGLDFVGRFNKKYVIGEAKFLTDFGGHQDTQFSDAISTITSSVDAITIAILDGVLYIKTKNKMHKNITETYSDYNIMSALVLRDFLYSL*

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.4%
Kalotermitidae 20.3%
Unclassified 13.0%
Formicidae 7.2%
Rhinotermitidae 5.8%
Termopsidae 4.3%
Hodotermitidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2684622742 Methanobrevibacter curvatus DSM11111 Isolate Unclassified
20 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2820025825 Unclassified Spirochaetes Lab288P1bin8 Isolate Unclassified
32 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
52 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
53 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
59 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
60 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
66 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
67 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
68 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
69 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
70 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
71 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_257675 3300042612 Bacteria 21585
2 Ga0466712_012164 3300042614 Bacteria 2123
3 Ga0466712_217288 3300042614 Bacteria 3404
4 Ga0466711_421374 3300042615 Bacteria 3253
5 Ga0466718_077799 3300042617 Bacteria 2269
6 Ga0466723_087233 3300042618 Unclassified 4907
7 Ga0466726_248239 3300042619 Bacteria 1686
8 Ga0466729_133234 3300042621 Unclassified 6354
9 Ga0466706_138670 3300042599 Bacteria 17605
10 Ga0466707_294232 3300042601 Bacteria 3157
11 Ga0466713_007347 3300042602 Bacteria 1543
12 Ga0466714_053027 3300042603 Bacteria 1683
13 Ga0466719_082516 3300042606 Bacteria 1259
14 Ga0466719_423274 3300042606 Bacteria 1773
15 Ga0072940_1044166 3300005200 Unclassified 3185
16 Ga0072941_1353510 3300005201 Bacteria 1252
17 Ga0466734_067446 3300042623 Bacteria 2093
18 Ga0466702_160181 3300042635 Bacteria 1571
19 Ga0466690_223274 3300042590 Bacteria 2515
20 Ga0466695_344238 3300042595 Bacteria 3363
21 Ga0123355_10016695 3300009826 Bacteria 11583
22 Ga0123353_10026823 3300010167 Bacteria 8810
23 Ga0123353_10417117 3300010167 Unclassified 1991
24 Ga0123354_10331729 3300010882 Unclassified 1385
25 Ga0466697_087367 3300042611 Bacteria 1343
26 Ga0466710_097916 3300042613 Bacteria 1494
27 Ga0466711_015953 3300042615 Bacteria 2630
28 Ga0466711_236984 3300042615 Bacteria 1619
29 Ga0466718_134484 3300042617 Bacteria 1377
30 Ga0466720_011308 3300042607 Bacteria 1648
31 JGI24698J34947_10014209 3300002449 Unclassified 4335
32 JGI24695J34938_10021559 3300002450 Bacteria 3148
33 JGI24702J35022_10039247 3300002462 Bacteria 2527
34 JGI24702J35022_10224090 3300002462 Bacteria 1085
35 JGI24696J40584_12943790 3300002834 Bacteria 1787
36 Ga0102734_1000250 3300007129 Bacteria 20105
37 Ga0466702_371511 3300042635 Bacteria 4194
38 Ga0466703_426152 3300042636 Bacteria 2368
39 Ga0466704_100779 3300042643 Unclassified 17435
40 Ga0466708_209984 3300042652 Bacteria 4374
41 Ga0264413_151874 3300024493 Bacteria 1433
42 Ga0466657_375050 3300042582 Bacteria 1341
43 Ga0466690_024123 3300042590 Bacteria 4047
44 Ga0466690_192552 3300042590 Bacteria 1266
45 Ga0466693_200661 3300042592 Bacteria 2528
46 Ga0466693_369346 3300042592 Bacteria 1538
47 Ga0123356_10115584 3300010049 Bacteria 2600
48 Ga0123353_11178435 3300010167 Bacteria 1008
49 Ga0466711_418449 3300042615 Bacteria 7652
50 Ga0466718_113412 3300042617 Bacteria 1209
51 Ga0466726_465860 3300042619 Bacteria 6629
52 Ga0466700_255159 3300042600 Bacteria 1923
53 Ga0466707_289605 3300042601 Bacteria 3081
54 Ga0466714_168011 3300042603 Bacteria 2550
55 Ga0466717_157528 3300042604 Bacteria 2038
56 Ga0466716_014562 3300042605 Bacteria 2311
57 Ga0466716_482624 3300042605 Unclassified 4730
58 Ga0466719_022205 3300042606 Bacteria 9780
59 2227278015 2225789004 Archaea 6848
60 JGI24702J35022_10008326 3300002462 Bacteria 5874
61 JGI24702J35022_10095903 3300002462 Bacteria 1618
62 Ga0072941_1390418 3300005201 Bacteria 2140
63 Ga0466735_006284 3300042624 Bacteria 1668
64 Ga0466735_066722 3300042624 Bacteria 2467
65 Ga0466704_509064 3300042643 Bacteria 2727
66 Ga0466708_364317 3300042652 Bacteria 9956
67 Ga0466727_019761 3300042655 Bacteria 1015
68 Ga0466690_232763 3300042590 Bacteria 1610
69 Ga0466690_380155 3300042590 Bacteria 3357
70 Ga0466691_042030 3300042593 Bacteria 3168
71 Ga0123357_10147296 3300009784 Bacteria 2870
72 Ga0123356_10049096 3300010049 Bacteria 3928
73 Ga0123353_10150317 3300010167 Bacteria 3719
74 Ga0123353_10289886 3300010167 Bacteria 2507
75 Ga0123353_10831167 3300010167 Bacteria 1270
76 Ga0123354_10312079 3300010882 Unclassified 1466
77 Ga0466705_445328 3300042612 Bacteria 1760
78 Ga0466711_067580 3300042615 Bacteria 6465
79 Ga0466715_050246 3300042616 Bacteria 2592
80 Ga0466715_365724 3300042616 Bacteria 1137
81 Ga0466718_124198 3300042617 Bacteria 1222
82 Ga0466726_108141 3300042619 Bacteria 2017
83 Ga0466706_034499 3300042599 Bacteria 31321
84 Ga0466707_244835 3300042601 Bacteria 2502
85 Ga0466713_013184 3300042602 Bacteria 3454
86 Ga0466714_076451 3300042603 Bacteria 1183
87 Ga0466717_249333 3300042604 Unclassified 2340
88 Ga0466719_076568 3300042606 Bacteria 6524
89 Ga0466722_263896 3300042609 Bacteria 3228
90 Ga0466698_347323 3300042610 Bacteria 1711
91 JGI24698J34947_10019871 3300002449 Unclassified 3619
92 JGI24702J35022_10122943 3300002462 Bacteria 1435
93 JGI24702J35022_10262676 3300002462 Unclassified 1008
94 Ga0068305_10078298 3300005083 Unclassified 1493
95 Ga0466731_125327 3300042622 Unclassified 15302
96 Ga0466709_123014 3300042648 Unclassified 2579
97 Ga0466708_294508 3300042652 Bacteria 46075
98 Ga0466725_022888 3300042654 Bacteria 2181
99 Ga0466691_123258 3300042593 Bacteria 1690
100 Ga0123356_10198107 3300010049 Unclassified 2046
101 Ga0123353_11186717 3300010167 Bacteria 1003
102 Ga0466733_079582 3300042659 Bacteria 3246
103 Ga0466712_108774 3300042614 Bacteria 1127
104 Ga0466711_148604 3300042615 Bacteria 1828
105 Ga0466715_050573 3300042616 Bacteria 7613
106 Ga0466723_346610 3300042618 Unclassified 2140
107 Ga0466726_158894 3300042619 Bacteria 1381
108 Ga0466728_226079 3300042620 Bacteria 2423
109 Ga0466729_125671 3300042621 Bacteria 2383
110 Ga0466706_272460 3300042599 Bacteria 119515
111 JGI24696J40584_12960941 3300002834 Bacteria 9548
112 Ga0072940_1027426 3300005200 Bacteria 2318
113 Ga0103265_1013842 3300007068 Unclassified 1053
114 Ga0102735_1000309 3300007080 Unclassified 18588
115 Ga0466704_127982 3300042643 Bacteria 28123
116 Ga0466727_001628 3300042655 Bacteria 1709
117 Ga0264413_101222 3300024493 Bacteria 6339
118 Ga0466690_165152 3300042590 Unclassified 3182
119 Ga0466692_121037 3300042591 Bacteria 2687
120 Ga0466696_123746 3300042596 Bacteria 3224
121 Ga0123357_10363574 3300009784 Bacteria 1367
122 Ga0123356_10690167 3300010049 Unclassified 1190
123 Ga0123353_10689554 3300010167 Unclassified 1436
124 Ga0466711_423266 3300042615 Bacteria 37149
125 Ga0466701_081495 3300042598 Bacteria 3361
126 Ga0466707_044020 3300042601 Bacteria 10192
127 Ga0466707_189241 3300042601 Bacteria 5638
128 Ga0466707_198931 3300042601 Bacteria 8885
129 Ga0466716_042436 3300042605 Unclassified 5273
130 Ga0466716_149541 3300042605 Bacteria 9311
131 Ga0466716_236306 3300042605 Bacteria 6323
132 Ga0466716_429742 3300042605 Bacteria 2397
133 Ga0466716_461578 3300042605 Bacteria 1301
134 Ga0466719_026307 3300042606 Bacteria 8745
135 JGI24698J34947_10031812 3300002449 Bacteria 2774
136 JGI24696J40584_12951311 3300002834 Bacteria 2231
137 Ga0072941_1126393 3300005201 Bacteria 2622
138 Ga0466731_033720 3300042622 Bacteria 2567
139 Ga0466708_189623 3300042652 Bacteria 33112
140 Ga0466691_045616 3300042593 Bacteria 3772
141 Ga0466699_135008 3300042597 Bacteria 3891
142 Ga0123356_10218495 3300010049 Bacteria 1960
143 Ga0123353_10170456 3300010167 Bacteria 3456
144 Ga0466705_025236 3300042612 Bacteria 4854
145 Ga0466733_101945 3300042659 Unclassified 1387
146 Ga0466705_456372 3300042612 Bacteria 15521
147 Ga0466712_197360 3300042614 Bacteria 8603
148 Ga0466715_313716 3300042616 Bacteria 6561
149 Ga0466718_147647 3300042617 Bacteria 15576
150 Ga0466718_156481 3300042617 Bacteria 1236
151 Ga0466718_158165 3300042617 Bacteria 1943
152 Ga0466706_183616 3300042599 Bacteria 1509
153 Ga0466706_200537 3300042599 Bacteria 3553
154 Ga0466713_053681 3300042602 Bacteria 3030
155 Ga0466713_054340 3300042602 Bacteria 5773
156 Ga0466719_557172 3300042606 Bacteria 3473
157 Ga0466720_090912 3300042607 Bacteria 1478
158 Ga0466721_027046 3300042608 Bacteria 2149
159 Ga0466721_226470 3300042608 Bacteria 2094
160 JGI24698J34947_10004925 3300002449 Bacteria 7317
161 Ga0466735_225000 3300042624 Bacteria 1205
162 Ga0466703_126847 3300042636 Bacteria 1936
163 Ga0466708_143936 3300042652 Bacteria 19825
164 Ga0466708_260058 3300042652 Bacteria 2479
165 Ga0466693_291076 3300042592 Bacteria 1658
166 Ga0466691_053230 3300042593 Bacteria 2856
167 Ga0466732_269704 3300042656 Bacteria 4569
168 Ga0466710_298606 3300042613 Bacteria 1723
169 Ga0466712_167405 3300042614 Unclassified 1051
170 Ga0466718_028738 3300042617 Bacteria 1046
171 Ga0466726_240206 3300042619 Bacteria 1827
172 Ga0466706_046747 3300042599 Bacteria 1789
173 Ga0466706_049086 3300042599 Bacteria 3285
174 Ga0466706_287434 3300042599 Bacteria 50218
175 Ga0466721_109141 3300042608 Bacteria 4510
176 Ga0103263_104786 3300007042 Bacteria 1559
177 Ga0102739_1000797 3300007095 Bacteria 8153
178 Ga0466731_175886 3300042622 Bacteria 1338
179 Ga0456237_0003353 3300041968 Bacteria 2599
180 Ga0466690_008807 3300042590 Bacteria 2479
181 Ga0466692_088241 3300042591 Bacteria 4424
182 Ga0466691_058858 3300042593 Bacteria 2248
183 Ga0466691_138871 3300042593 Bacteria 9926
184 Ga0466694_014085 3300042594 Bacteria 6200
185 Ga0466699_206844 3300042597 Bacteria 1047
186 Ga0123356_10411817 3300010049 Bacteria 1492

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_313716 Ga0466715_313716_1573_2277 234
2 3300042616 Ga0466715_365724 Ga0466715_365724_93_800 235
3 3300042602 Ga0466713_013184 Ga0466713_013184_164_880 238
4 3300042612 Ga0466705_456372 Ga0466705_456372_7359_8081 240
5 3300042652 Ga0466708_209984 Ga0466708_209984_3497_4219 240
6 3300042598 Ga0466701_081495 Ga0466701_081495_2053_2835 242
7 3300042615 Ga0466711_236984 Ga0466711_236984_40_771 243
8 3300042617 Ga0466718_124198 Ga0466718_124198_10_741 243
9 3300042615 Ga0466711_423266 Ga0466711_423266_28492_29235 247
10 3300042624 Ga0466735_225000 Ga0466735_225000_256_1005 249
11 3300042597 Ga0466699_135008 Ga0466699_135008_1933_2715 251
12 3300042604 Ga0466717_157528 Ga0466717_157528_381_1163 252
13 3300042605 Ga0466716_014562 Ga0466716_014562_1242_2000 252
14 3300007080 Ga0102735_1000309 Ga0102735_100030911 254
15 iso_pr_bacteria 2820025825 2820026720 254
16 3300042615 Ga0466711_015953 Ga0466711_015953_192_962 256
17 3300042615 Ga0466711_418449 Ga0466711_418449_1497_2276 259
18 3300042621 Ga0466729_133234 Ga0466729_133234_2495_3274 259
19 iso_pu_archaea 2684622742 2685522176 259
20 3300007068 Ga0103265_1013842 Ga0103265_10138422 260
21 3300007095 Ga0102739_1000797 Ga0102739_10007974 260
22 3300007129 Ga0102734_1000250 Ga0102734_10002504 260
23 3300024493 Ga0264413_101222 Ga0264413_1012224 260
24 3300024493 Ga0264413_151874 Ga0264413_1518741 260
25 3300041968 Ga0456237_0003353 Ga0456237_0003353_204_986 260
26 3300042582 Ga0466657_375050 Ga0466657_375050_403_1185 260
27 3300042590 Ga0466690_008807 Ga0466690_008807_1485_2267 260
28 3300042590 Ga0466690_165152 Ga0466690_165152_1198_1980 260
29 3300042590 Ga0466690_232763 Ga0466690_232763_727_1509 260
30 3300042591 Ga0466692_088241 Ga0466692_088241_330_1112 260
31 3300042592 Ga0466693_200661 Ga0466693_200661_20_802 260
32 3300042592 Ga0466693_291076 Ga0466693_291076_471_1253 260
33 3300042592 Ga0466693_369346 Ga0466693_369346_148_930 260
34 3300042593 Ga0466691_042030 Ga0466691_042030_270_1052 260
35 3300042593 Ga0466691_045616 Ga0466691_045616_568_1350 260
36 3300042593 Ga0466691_053230 Ga0466691_053230_1043_1825 260
37 3300042593 Ga0466691_058858 Ga0466691_058858_197_979 260
38 3300042593 Ga0466691_123258 Ga0466691_123258_683_1465 260
39 3300042593 Ga0466691_138871 Ga0466691_138871_8628_9410 260
40 3300042594 Ga0466694_014085 Ga0466694_014085_4777_5559 260
41 3300042595 Ga0466695_344238 Ga0466695_344238_495_1277 260
42 3300042596 Ga0466696_123746 Ga0466696_123746_2095_2877 260
43 3300042597 Ga0466699_206844 Ga0466699_206844_147_929 260
44 3300042599 Ga0466706_034499 Ga0466706_034499_28952_29734 260
45 3300042599 Ga0466706_046747 Ga0466706_046747_346_1128 260
46 3300042599 Ga0466706_138670 Ga0466706_138670_439_1221 260
47 3300042599 Ga0466706_200537 Ga0466706_200537_283_1065 260
48 3300042599 Ga0466706_272460 Ga0466706_272460_91985_92767 260
49 3300042599 Ga0466706_287434 Ga0466706_287434_46875_47657 260
50 3300042600 Ga0466700_255159 Ga0466700_255159_968_1750 260
51 3300042601 Ga0466707_044020 Ga0466707_044020_8481_9263 260
52 3300042601 Ga0466707_198931 Ga0466707_198931_6007_6789 260
53 3300042601 Ga0466707_244835 Ga0466707_244835_258_1040 260
54 3300042601 Ga0466707_289605 Ga0466707_289605_1195_1977 260
55 3300042601 Ga0466707_294232 Ga0466707_294232_1117_1899 260
56 3300042602 Ga0466713_054340 Ga0466713_054340_1529_2311 260
57 3300042603 Ga0466714_053027 Ga0466714_053027_67_849 260
58 3300042603 Ga0466714_076451 Ga0466714_076451_226_1008 260
59 3300042604 Ga0466717_249333 Ga0466717_249333_1061_1843 260
60 3300042605 Ga0466716_042436 Ga0466716_042436_4437_5219 260
61 3300042605 Ga0466716_149541 Ga0466716_149541_7011_7793 260
62 3300042605 Ga0466716_236306 Ga0466716_236306_311_1093 260
63 3300042605 Ga0466716_429742 Ga0466716_429742_1203_1985 260
64 3300042605 Ga0466716_461578 Ga0466716_461578_179_961 260
65 3300042605 Ga0466716_482624 Ga0466716_482624_2588_3370 260
66 3300042606 Ga0466719_022205 Ga0466719_022205_8093_8875 260
67 3300042606 Ga0466719_026307 Ga0466719_026307_1457_2239 260
68 3300042606 Ga0466719_076568 Ga0466719_076568_4531_5313 260
69 3300042606 Ga0466719_082516 Ga0466719_082516_350_1132 260
70 3300042606 Ga0466719_557172 Ga0466719_557172_2233_3015 260
71 3300042607 Ga0466720_011308 Ga0466720_011308_800_1582 260
72 3300042607 Ga0466720_090912 Ga0466720_090912_562_1344 260
73 3300042608 Ga0466721_027046 Ga0466721_027046_196_978 260
74 3300042608 Ga0466721_109141 Ga0466721_109141_1468_2250 260
75 3300042608 Ga0466721_226470 Ga0466721_226470_368_1150 260
76 3300042610 Ga0466698_347323 Ga0466698_347323_777_1559 260
77 3300042611 Ga0466697_087367 Ga0466697_087367_143_925 260
78 3300042612 Ga0466705_025236 Ga0466705_025236_500_1282 260
79 3300042612 Ga0466705_257675 Ga0466705_257675_11707_12489 260
80 3300042612 Ga0466705_445328 Ga0466705_445328_41_823 260
81 3300042613 Ga0466710_097916 Ga0466710_097916_32_814 260
82 3300042613 Ga0466710_298606 Ga0466710_298606_446_1228 260
83 3300042614 Ga0466712_012164 Ga0466712_012164_469_1251 260
84 3300042614 Ga0466712_108774 Ga0466712_108774_200_982 260
85 3300042614 Ga0466712_167405 Ga0466712_167405_200_982 260
86 3300042614 Ga0466712_197360 Ga0466712_197360_5941_6723 260
87 3300042614 Ga0466712_217288 Ga0466712_217288_1843_2625 260
88 3300042615 Ga0466711_067580 Ga0466711_067580_849_1631 260
89 3300042615 Ga0466711_421374 Ga0466711_421374_1460_2242 260
90 3300042617 Ga0466718_028738 Ga0466718_028738_79_861 260
91 3300042617 Ga0466718_077799 Ga0466718_077799_1038_1820 260
92 3300042617 Ga0466718_113412 Ga0466718_113412_135_917 260
93 3300042617 Ga0466718_134484 Ga0466718_134484_463_1245 260
94 3300042617 Ga0466718_147647 Ga0466718_147647_688_1470 260
95 3300042617 Ga0466718_156481 Ga0466718_156481_331_1113 260
96 3300042617 Ga0466718_158165 Ga0466718_158165_971_1753 260
97 3300042618 Ga0466723_087233 Ga0466723_087233_2277_3059 260
98 3300042618 Ga0466723_346610 Ga0466723_346610_984_1766 260
99 3300042619 Ga0466726_108141 Ga0466726_108141_769_1551 260
100 3300042619 Ga0466726_158894 Ga0466726_158894_482_1264 260
101 3300042619 Ga0466726_240206 Ga0466726_240206_313_1095 260
102 3300042620 Ga0466728_226079 Ga0466728_226079_1499_2281 260
103 3300042621 Ga0466729_125671 Ga0466729_125671_560_1342 260
104 3300042622 Ga0466731_033720 Ga0466731_033720_556_1338 260
105 3300042622 Ga0466731_125327 Ga0466731_125327_11277_12059 260
106 3300042622 Ga0466731_175886 Ga0466731_175886_452_1234 260
107 3300042623 Ga0466734_067446 Ga0466734_067446_1134_1916 260
108 3300042624 Ga0466735_006284 Ga0466735_006284_699_1481 260
109 3300042624 Ga0466735_066722 Ga0466735_066722_69_851 260
110 3300042635 Ga0466702_160181 Ga0466702_160181_668_1450 260
111 3300042635 Ga0466702_371511 Ga0466702_371511_498_1280 260
112 3300042636 Ga0466703_126847 Ga0466703_126847_125_907 260
113 3300042636 Ga0466703_426152 Ga0466703_426152_278_1060 260
114 3300042643 Ga0466704_100779 Ga0466704_100779_2253_3035 260
115 3300042643 Ga0466704_127982 Ga0466704_127982_10886_11668 260
116 3300042648 Ga0466709_123014 Ga0466709_123014_1539_2321 260
117 3300042652 Ga0466708_143936 Ga0466708_143936_4469_5251 260
118 3300042652 Ga0466708_260058 Ga0466708_260058_1422_2204 260
119 3300042652 Ga0466708_294508 Ga0466708_294508_23650_24432 260
120 3300042654 Ga0466725_022888 Ga0466725_022888_1011_1793 260
121 3300042655 Ga0466727_001628 Ga0466727_001628_699_1481 260
122 3300042656 Ga0466732_269704 Ga0466732_269704_856_1638 260
123 3300042659 Ga0466733_101945 Ga0466733_101945_88_870 260
124 iso_pr_bacteria 2820180635 2820183149 260
125 iso_pr_bacteria 2820737921 2820739267 260
126 iso_pr_bacteria 2820744581 2820744680 260
127 iso_pr_bacteria 2820746860 2820747079 260
128 3300002449 JGI24698J34947_10004925 JGI24698J34947_100049253 261
129 3300002449 JGI24698J34947_10014209 JGI24698J34947_100142093 261
130 3300002449 JGI24698J34947_10019871 JGI24698J34947_100198712 261
131 3300002450 JGI24695J34938_10021559 JGI24695J34938_100215593 261
132 3300002462 JGI24702J35022_10008326 JGI24702J35022_100083265 261
133 3300002462 JGI24702J35022_10039247 JGI24702J35022_100392472 261
134 3300002462 JGI24702J35022_10095903 JGI24702J35022_100959031 261
135 3300002462 JGI24702J35022_10122943 JGI24702J35022_101229431 261
136 3300002462 JGI24702J35022_10224090 JGI24702J35022_102240901 261
137 3300002462 JGI24702J35022_10262676 JGI24702J35022_102626761 261
138 3300002834 JGI24696J40584_12943790 JGI24696J40584_129437902 261
139 3300002834 JGI24696J40584_12960941 JGI24696J40584_129609415 261
140 3300005083 Ga0068305_10078298 Ga0068305_100782982 261
141 3300005200 Ga0072940_1027426 Ga0072940_10274261 261
142 3300005200 Ga0072940_1044166 Ga0072940_10441663 261
143 3300005201 Ga0072941_1126393 Ga0072941_11263932 261
144 3300005201 Ga0072941_1353510 Ga0072941_13535102 261
145 3300005201 Ga0072941_1390418 Ga0072941_13904181 261
146 3300009784 Ga0123357_10147296 Ga0123357_101472962 261
147 3300009784 Ga0123357_10363574 Ga0123357_103635741 261
148 3300009826 Ga0123355_10016695 Ga0123355_100166954 261
149 3300010049 Ga0123356_10049096 Ga0123356_100490965 261
150 3300010049 Ga0123356_10115584 Ga0123356_101155842 261
151 3300010049 Ga0123356_10198107 Ga0123356_101981072 261
152 3300010049 Ga0123356_10411817 Ga0123356_104118172 261
153 3300010049 Ga0123356_10690167 Ga0123356_106901672 261
154 3300010167 Ga0123353_10026823 Ga0123353_100268236 261
155 3300010167 Ga0123353_10150317 Ga0123353_101503173 261
156 3300010167 Ga0123353_10170456 Ga0123353_101704563 261
157 3300010167 Ga0123353_10289886 Ga0123353_102898863 261
158 3300010167 Ga0123353_10417117 Ga0123353_104171172 261
159 3300010167 Ga0123353_10689554 Ga0123353_106895541 261
160 3300010167 Ga0123353_11178435 Ga0123353_111784351 261
161 3300010167 Ga0123353_11186717 Ga0123353_111867172 261
162 3300010882 Ga0123354_10312079 Ga0123354_103120792 261
163 3300042602 Ga0466713_007347 Ga0466713_007347_96_881 261
164 3300042609 Ga0466722_263896 Ga0466722_263896_182_967 261
165 3300042619 Ga0466726_465860 Ga0466726_465860_1636_2421 261
166 3300042652 Ga0466708_364317 Ga0466708_364317_8399_9184 261
167 3300042659 Ga0466733_079582 Ga0466733_079582_1159_1944 261
168 3300042590 Ga0466690_223274 Ga0466690_223274_1390_2181 263
169 3300042599 Ga0466706_049086 Ga0466706_049086_1451_2242 263
170 2225789004 2227278015 2227729677 264
171 3300002834 JGI24696J40584_12951311 JGI24696J40584_129513113 264
172 3300042590 Ga0466690_380155 Ga0466690_380155_266_1060 264
173 3300042591 Ga0466692_121037 Ga0466692_121037_1008_1802 264
174 3300042601 Ga0466707_189241 Ga0466707_189241_1822_2616 264
175 3300042606 Ga0466719_423274 Ga0466719_423274_505_1299 264
176 3300042616 Ga0466715_050573 Ga0466715_050573_1587_2381 264
177 3300042619 Ga0466726_248239 Ga0466726_248239_111_905 264
178 3300042643 Ga0466704_509064 Ga0466704_509064_1403_2200 265
179 3300007042 Ga0103263_104786 Ga0103263_1047862 266
180 3300010167 Ga0123353_10831167 Ga0123353_108311672 266
181 3300010882 Ga0123354_10331729 Ga0123354_103317292 266
182 3300042615 Ga0466711_148604 Ga0466711_148604_134_934 266
183 3300042652 Ga0466708_189623 Ga0466708_189623_30796_31596 266
184 3300042590 Ga0466690_024123 Ga0466690_024123_1091_1894 267
185 3300042616 Ga0466715_050246 Ga0466715_050246_281_1084 267
186 3300042655 Ga0466727_019761 Ga0466727_019761_194_997 267
187 3300042590 Ga0466690_192552 Ga0466690_192552_401_1213 270
188 3300042599 Ga0466706_183616 Ga0466706_183616_98_916 272
189 3300010049 Ga0123356_10218495 Ga0123356_102184952 275
190 3300042603 Ga0466714_168011 Ga0466714_168011_1605_2435 276
191 3300042602 Ga0466713_053681 Ga0466713_053681_512_1363 283
192 3300002449 JGI24698J34947_10031812 JGI24698J34947_100318123 287

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06300 Tsp45I Tsp45I type II restriction enzyme 30 286 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.