Protein Family IF00499
Metagenome
Isolate
134
Members
51
Samples
128
Scaffolds
139.15
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10010428|JGI24698J34947_100104288
- Length
- 154 aa
- Sequence
- MKKIVIDINIFMDFLFKREGHEKAAEIFSICSKGEIKGFVCAHEITTLYYFLNKAAKDKIKIRKTLSGIMNRFTVIEINAEILNKALVSEISDFEDAVIEASAVDIKADCILTGNIKDFKKSIVNAVTPEELLVIPEAGKNRNPGRINVRRKQ*
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.1%
Unclassified
18.8%
Kalotermitidae
16.7%
Termopsidae
8.3%
Rhinotermitidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 25 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 26 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_109746 | 3300042619 | Bacteria | 4465 |
| 2 | Ga0466726_123430 | 3300042619 | Bacteria | 20370 |
| 3 | Ga0466726_340611 | 3300042619 | Bacteria | 1573 |
| 4 | Ga0123357_10393500 | 3300009784 | Bacteria | 1270 |
| 5 | Ga0123353_10257637 | 3300010167 | Bacteria | 2697 |
| 6 | Ga0466713_082682 | 3300042602 | Bacteria | 1953 |
| 7 | Ga0466719_133775 | 3300042606 | Bacteria | 3347 |
| 8 | Ga0466720_071997 | 3300042607 | Bacteria | 33952 |
| 9 | Ga0466691_035943 | 3300042593 | Bacteria | 6513 |
| 10 | JGI24698J34947_10228377 | 3300002449 | Bacteria | 709 |
| 11 | JGI24696J40584_12858922 | 3300002834 | Unclassified | 1005 |
| 12 | Ga0466704_365062 | 3300042643 | Bacteria | 22156 |
| 13 | Ga0466727_274710 | 3300042655 | Bacteria | 2464 |
| 14 | Ga0466732_181478 | 3300042656 | Bacteria | 5322 |
| 15 | Ga0466733_156764 | 3300042659 | Bacteria | 1616 |
| 16 | Ga0123355_10004648 | 3300009826 | Bacteria | 19974 |
| 17 | Ga0123354_10211172 | 3300010882 | Bacteria | 2097 |
| 18 | Ga0466721_220378 | 3300042608 | Bacteria | 49670 |
| 19 | JGI24695J34938_10101369 | 3300002450 | Bacteria | 1176 |
| 20 | JGI24702J35022_10028045 | 3300002462 | Bacteria | 3028 |
| 21 | Ga0068305_10156928 | 3300005083 | Bacteria | 727 |
| 22 | Ga0072940_1088055 | 3300005200 | Bacteria | 513 |
| 23 | Ga0072941_1034926 | 3300005201 | Bacteria | 4201 |
| 24 | Ga0466731_221857 | 3300042622 | Bacteria | 1645 |
| 25 | Ga0466735_158823 | 3300042624 | Bacteria | 1864 |
| 26 | Ga0466703_313744 | 3300042636 | Bacteria | 2352 |
| 27 | Ga0466711_301913 | 3300042615 | Bacteria | 2362 |
| 28 | Ga0466726_318360 | 3300042619 | Bacteria | 1043 |
| 29 | Ga0123357_10012898 | 3300009784 | Bacteria | 10799 |
| 30 | Ga0123356_10414232 | 3300010049 | Bacteria | 1488 |
| 31 | Ga0123356_11725695 | 3300010049 | Bacteria | 777 |
| 32 | Ga0123356_11790149 | 3300010049 | Bacteria | 763 |
| 33 | Ga0123353_10399344 | 3300010167 | Bacteria | 2047 |
| 34 | Ga0466699_066759 | 3300042597 | Bacteria | 2535 |
| 35 | JGI24698J34947_10077998 | 3300002449 | Bacteria | 1564 |
| 36 | JGI24698J34947_10155978 | 3300002449 | Bacteria | 941 |
| 37 | JGI24695J34938_10113432 | 3300002450 | Bacteria | 1104 |
| 38 | Ga0068305_10127191 | 3300005083 | Bacteria | 3864 |
| 39 | Ga0466708_256052 | 3300042652 | Bacteria | 3465 |
| 40 | Ga0466727_045490 | 3300042655 | Bacteria | 14015 |
| 41 | Ga0466712_194281 | 3300042614 | Bacteria | 1621 |
| 42 | Ga0466711_063833 | 3300042615 | Unclassified | 1055 |
| 43 | Ga0466723_095135 | 3300042618 | Bacteria | 5032 |
| 44 | Ga0466726_490812 | 3300042619 | Bacteria | 1101 |
| 45 | Ga0123355_10932300 | 3300009826 | Bacteria | 936 |
| 46 | Ga0123356_10423886 | 3300010049 | Bacteria | 1473 |
| 47 | Ga0123353_10912435 | 3300010167 | Bacteria | 1194 |
| 48 | Ga0123354_10106579 | 3300010882 | Bacteria | 3739 |
| 49 | Ga0466707_070375 | 3300042601 | Bacteria | 1084 |
| 50 | Ga0466707_251754 | 3300042601 | Bacteria | 1994 |
| 51 | JGI24698J34947_10010428 | 3300002449 | Bacteria | 5096 |
| 52 | JGI24698J34947_10035994 | 3300002449 | Unclassified | 2579 |
| 53 | JGI24698J34947_10063224 | 3300002449 | Bacteria | 1815 |
| 54 | JGI24695J34938_10006852 | 3300002450 | Bacteria | 6765 |
| 55 | JGI24702J35022_10078887 | 3300002462 | Bacteria | 1782 |
| 56 | Ga0466733_096003 | 3300042659 | Bacteria | 1773 |
| 57 | Ga0466712_029135 | 3300042614 | Bacteria | 4117 |
| 58 | Ga0466712_043337 | 3300042614 | Unclassified | 4746 |
| 59 | Ga0466712_115270 | 3300042614 | Bacteria | 3675 |
| 60 | Ga0466712_119542 | 3300042614 | Unclassified | 4616 |
| 61 | Ga0466711_272816 | 3300042615 | Bacteria | 1107 |
| 62 | Ga0123353_10140734 | 3300010167 | Bacteria | 3865 |
| 63 | Ga0466706_038903 | 3300042599 | Bacteria | 1267 |
| 64 | Ga0265387_1056497 | 3300024582 | Bacteria | 720 |
| 65 | Ga0415639_073201 | 3300038395 | Bacteria | 6306 |
| 66 | Ga0415639_163960 | 3300038395 | Bacteria | 2603 |
| 67 | JGI24698J34947_10071335 | 3300002449 | Bacteria | 1667 |
| 68 | JGI24698J34947_10124391 | 3300002449 | Bacteria | 1113 |
| 69 | JGI24695J34938_10005725 | 3300002450 | Bacteria | 7670 |
| 70 | JGI24696J40584_12868217 | 3300002834 | Bacteria | 1036 |
| 71 | Ga0068302_10120504 | 3300005071 | Bacteria | 708 |
| 72 | Ga0466735_204178 | 3300042624 | Bacteria | 1828 |
| 73 | Ga0466704_034571 | 3300042643 | Bacteria | 3149 |
| 74 | Ga0466732_028124 | 3300042656 | Bacteria | 3196 |
| 75 | Ga0466712_171938 | 3300042614 | Bacteria | 10478 |
| 76 | Ga0466718_091810 | 3300042617 | Bacteria | 2955 |
| 77 | Ga0466718_096642 | 3300042617 | Bacteria | 1334 |
| 78 | Ga0123356_10009404 | 3300010049 | Bacteria | 9657 |
| 79 | Ga0123353_10612395 | 3300010167 | Unclassified | 1553 |
| 80 | Ga0123353_10821266 | 3300010167 | Bacteria | 1280 |
| 81 | Ga0466700_321963 | 3300042600 | Bacteria | 1229 |
| 82 | Ga0466690_395330 | 3300042590 | Bacteria | 1572 |
| 83 | Ga0466699_177362 | 3300042597 | Unclassified | 12488 |
| 84 | JGI24698J34947_10168651 | 3300002449 | Bacteria | 889 |
| 85 | JGI24695J34938_10001411 | 3300002450 | Bacteria | 20486 |
| 86 | JGI24695J34938_10024722 | 3300002450 | Bacteria | 2881 |
| 87 | JGI24695J34938_10338971 | 3300002450 | Bacteria | 658 |
| 88 | JGI24695J34938_10490959 | 3300002450 | Bacteria | 560 |
| 89 | JGI24699J35502_10645368 | 3300002509 | Unclassified | 717 |
| 90 | Ga0072941_1034906 | 3300005201 | Bacteria | 668 |
| 91 | Ga0466735_142080 | 3300042624 | Bacteria | 2458 |
| 92 | Ga0466727_016833 | 3300042655 | Bacteria | 2532 |
| 93 | Ga0466712_128949 | 3300042614 | Bacteria | 2050 |
| 94 | Ga0466726_398657 | 3300042619 | Unclassified | 1020 |
| 95 | Ga0123353_10642440 | 3300010167 | Bacteria | 1504 |
| 96 | Ga0123353_11296583 | 3300010167 | Bacteria | 946 |
| 97 | Ga0466719_073028 | 3300042606 | Bacteria | 2438 |
| 98 | Ga0466722_256308 | 3300042609 | Bacteria | 1094 |
| 99 | Ga0264413_134697 | 3300024493 | Bacteria | 3361 |
| 100 | Ga0415639_184631 | 3300038395 | Bacteria | 1522 |
| 101 | Ga0415639_188262 | 3300038395 | Bacteria | 1772 |
| 102 | JGI24698J34947_10173176 | 3300002449 | Unclassified | 871 |
| 103 | JGI24697J35500_10958611 | 3300002507 | Bacteria | 881 |
| 104 | Ga0466733_052773 | 3300042659 | Bacteria | 1320 |
| 105 | Ga0466733_174642 | 3300042659 | Bacteria | 1513 |
| 106 | Ga0466712_058080 | 3300042614 | Bacteria | 9397 |
| 107 | Ga0466712_282479 | 3300042614 | Bacteria | 17395 |
| 108 | Ga0466711_376238 | 3300042615 | Bacteria | 16015 |
| 109 | Ga0466718_047523 | 3300042617 | Unclassified | 2233 |
| 110 | Ga0466718_092754 | 3300042617 | Bacteria | 3619 |
| 111 | Ga0466726_001268 | 3300042619 | Bacteria | 1277 |
| 112 | Ga0123357_10114112 | 3300009784 | Bacteria | 3431 |
| 113 | Ga0123356_11670880 | 3300010049 | Bacteria | 789 |
| 114 | Ga0123353_11187937 | 3300010167 | Bacteria | 1002 |
| 115 | Ga0123354_10036923 | 3300010882 | Bacteria | 7613 |
| 116 | Ga0466701_026979 | 3300042598 | Bacteria | 1058 |
| 117 | Ga0466700_113580 | 3300042600 | Bacteria | 3709 |
| 118 | Ga0466707_193076 | 3300042601 | Bacteria | 27621 |
| 119 | Ga0466721_377791 | 3300042608 | Bacteria | 1579 |
| 120 | Ga0466698_169096 | 3300042610 | Bacteria | 1136 |
| 121 | Ga0264413_130017 | 3300024493 | Bacteria | 1387 |
| 122 | Ga0466699_391965 | 3300042597 | Bacteria | 3223 |
| 123 | JGI24698J34947_10032749 | 3300002449 | Bacteria | 2728 |
| 124 | JGI24702J35022_10101600 | 3300002462 | Bacteria | 1575 |
| 125 | JGI24696J40584_12732742 | 3300002834 | Bacteria | 772 |
| 126 | JGI24696J40584_12911830 | 3300002834 | Bacteria | 1263 |
| 127 | Ga0072940_1139949 | 3300005200 | Bacteria | 941 |
| 128 | Ga0074263_109010 | 3300005485 | Bacteria | 1557 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.