Protein Family IF00492
Metagenome
Isolate
171
Members
117
Samples
106
Scaffolds
422.67
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10005769|JGI24698J34947_100057694
- Length
- 455 aa
- Sequence
- MGINFPIPYTLSLKFKAIFYIPLMKTLSQTDPDIQALITKETERQEDGIELXASENYASKAVMEALGSPLTNKYSEGYVGKRXYGGNEIIDEVEAFAIERSKLLFGCEHVNVQPLSGSPANAAVYFATIKPGDKVLGLQLDHGGHLSHGHPVNFSGMLYNFTQYQVDKNTGRIDMDKVREIALREKPKMILAGFSAYSRNMEWKKFKEIADEIGAITFADIAHIAGLIAGKAIESPVPYFDIVSTTTHKTLRGPRGAIIMCKEPFAKAIDKSVFPGMQGGPHDHVTAAKAVAFEEALQPEFQTYAKRVIENAQAMAAKLMEAGFKIISDGTDNHLMVVDVTSKGISGKEAETILDKVGISTSRSTIPFDPRKPMDPSGVRLGTAAITTRGFDVEDTCAVAEFITQAIENRSDEAKLKRIRESLLELCKKRPLYNFPRAAPQTHSTPANQWIFPV*
Sample Types
Isolate
38.0%
Metagenome
62.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.0%
Unclassified
21.2%
Elmidae
5.3%
Kalotermitidae
5.3%
Drosophilidae
4.4%
Formicidae
4.4%
Pyralidae
4.4%
Rhinotermitidae
3.5%
Scarabaeidae
3.5%
Cambaridae
2.7%
Bombycidae
1.8%
Blattidae
1.8%
Culicidae
1.8%
Apidae
1.8%
Termopsidae
1.8%
Stratiomyidae
0.9%
Ixodidae
0.9%
Hodotermitidae
0.9%
Nephropidae
0.9%
Ocypodidae
0.9%
Noctuidae
0.9%
Eresidae
0.9%
Armadillidiidae
0.9%
Pentatomidae
0.9%
Carabidae
0.9%
Portunidae
0.9%
Hydrophilidae
0.9%
Curculionidae
0.9%
Dytiscidae
0.9%
Muscidae
0.9%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 2 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 3 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 4 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 11 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 15 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 16 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 17 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 18 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 19 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 23 | 650716015 | Candidatus Midichloria mitochondrii IricVA | Isolate | Ixodidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 34 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 35 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 36 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 37 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 38 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 39 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 40 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 41 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 47 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 48 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 49 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 50 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 51 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 52 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 53 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 54 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 55 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 56 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 57 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 58 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 59 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 62 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 63 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 64 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 65 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 66 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 67 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 68 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 69 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 70 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 71 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 72 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 73 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 74 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 75 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 76 | 8002448939 | Spiroplasma endosymbiont of 'Nebria riversi' Nriv7 | Isolate | Carabidae |
| 77 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 78 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 79 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 80 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 81 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 82 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 83 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 84 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 85 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 86 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 87 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 88 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 89 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 90 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 91 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 92 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 93 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 94 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 95 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 96 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 97 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 98 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 99 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 100 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 101 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 102 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 103 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 104 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 105 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 106 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 107 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 108 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 109 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 110 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 111 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 112 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 113 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 114 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 115 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 116 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 117 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0072940_1009313 | 3300005200 | Bacteria | 7759 |
| 2 | Ga0072941_1007967 | 3300005201 | Bacteria | 24670 |
| 3 | Ga0072941_1012473 | 3300005201 | Bacteria | 38576 |
| 4 | Ga0072941_1035674 | 3300005201 | Bacteria | 19410 |
| 5 | Ga0415639_288935 | 3300038395 | Bacteria | 1772 |
| 6 | Ga0466690_262098 | 3300042590 | Bacteria | 18620 |
| 7 | Ga0466694_256579 | 3300042594 | Bacteria | 16228 |
| 8 | Ga0466712_154198 | 3300042614 | Unclassified | 11660 |
| 9 | Ga0466715_277482 | 3300042616 | Bacteria | 4944 |
| 10 | Ga0466707_285379 | 3300042601 | Bacteria | 21230 |
| 11 | Ga0466707_315343 | 3300042601 | Unclassified | 2319 |
| 12 | Ga0466717_046333 | 3300042604 | Bacteria | 2276 |
| 13 | Ga0466720_048373 | 3300042607 | Bacteria | 52781 |
| 14 | Ga0466732_246007 | 3300042656 | Unclassified | 2087 |
| 15 | AustNasuHG_c1002081 | 3300000089 | Bacteria | 7233 |
| 16 | JGI24698J34947_10033727 | 3300002449 | Unclassified | 2683 |
| 17 | CVPL010W_10000112 | 3300002931 | Bacteria | 60598 |
| 18 | Ga0074278_134149 | 3300005721 | Bacteria | 51171 |
| 19 | Ga0466718_013982 | 3300042617 | Bacteria | 9966 |
| 20 | Ga0466718_052453 | 3300042617 | Bacteria | 2252 |
| 21 | Ga0123353_10128696 | 3300010167 | Unclassified | 4066 |
| 22 | Ga0123353_10334752 | 3300010167 | Bacteria | 2289 |
| 23 | Ga0466707_022879 | 3300042601 | Bacteria | 60320 |
| 24 | Ga0466707_102875 | 3300042601 | Bacteria | 1822 |
| 25 | Ga0466713_108990 | 3300042602 | Bacteria | 3086 |
| 26 | Ga0466722_238729 | 3300042609 | Bacteria | 12339 |
| 27 | Ga0466734_005327 | 3300042623 | Bacteria | 3481 |
| 28 | Ga0466702_280281 | 3300042635 | Bacteria | 2190 |
| 29 | JGI24698J34947_10022259 | 3300002449 | Bacteria | 3402 |
| 30 | JGI24695J34938_10003405 | 3300002450 | Bacteria | 11149 |
| 31 | Ga0072941_1027518 | 3300005201 | Bacteria | 39253 |
| 32 | Ga0074278_128543 | 3300005721 | Bacteria | 4061 |
| 33 | Ga0456237_0000087 | 3300041968 | Bacteria | 12748 |
| 34 | Ga0466694_194862 | 3300042594 | Bacteria | 3419 |
| 35 | Ga0466715_519306 | 3300042616 | Bacteria | 2824 |
| 36 | Ga0466726_415010 | 3300042619 | Bacteria | 15579 |
| 37 | Ga0123355_10319215 | 3300009826 | Bacteria | 2095 |
| 38 | Ga0123353_10117026 | 3300010167 | Bacteria | 4288 |
| 39 | Ga0160442_100970 | 3300012806 | Bacteria | 4018 |
| 40 | Ga0466720_089430 | 3300042607 | Bacteria | 42964 |
| 41 | Ga0466702_011540 | 3300042635 | Bacteria | 2014 |
| 42 | Ga0466708_068118 | 3300042652 | Bacteria | 6880 |
| 43 | Ga0466705_147979 | 3300042612 | Bacteria | 167577 |
| 44 | JGI24705J35276_12237986 | 3300002504 | Bacteria | 14710 |
| 45 | JGI24699J35502_11132437 | 3300002509 | Unclassified | 6865 |
| 46 | Ga0415639_006795 | 3300038395 | Bacteria | 14399 |
| 47 | Ga0466726_338034 | 3300042619 | Bacteria | 2862 |
| 48 | Ga0123357_10009523 | 3300009784 | Bacteria | 12270 |
| 49 | Ga0466713_086110 | 3300042602 | Bacteria | 3292 |
| 50 | Ga0466721_008626 | 3300042608 | Bacteria | 25610 |
| 51 | Ga0466731_379732 | 3300042622 | Bacteria | 31002 |
| 52 | Ga0466730_029885 | 3300042625 | Bacteria | 18252 |
| 53 | JGI24698J34947_10003352 | 3300002449 | Bacteria | 8695 |
| 54 | JGI24698J34947_10005769 | 3300002449 | Bacteria | 6789 |
| 55 | CVPL010W_10000168 | 3300002931 | Bacteria | 56046 |
| 56 | Ga0072941_1023514 | 3300005201 | Bacteria | 14411 |
| 57 | Ga0103264_1000499 | 3300007188 | Bacteria | 32791 |
| 58 | Ga0466696_021862 | 3300042596 | Bacteria | 18962 |
| 59 | Ga0466712_178204 | 3300042614 | Bacteria | 10590 |
| 60 | Ga0466718_011023 | 3300042617 | Unclassified | 3564 |
| 61 | Ga0160471_101298 | 3300012812 | Bacteria | 5134 |
| 62 | Ga0466706_044135 | 3300042599 | Bacteria | 3498 |
| 63 | Ga0466706_244002 | 3300042599 | Bacteria | 5169 |
| 64 | Ga0466707_309775 | 3300042601 | Unclassified | 2267 |
| 65 | Ga0466704_392400 | 3300042643 | Bacteria | 3942 |
| 66 | Ga0466708_034858 | 3300042652 | Bacteria | 35107 |
| 67 | Ga0466732_110176 | 3300042656 | Bacteria | 8366 |
| 68 | Ga0102740_1000134 | 3300007140 | Bacteria | 19620 |
| 69 | Ga0466692_092853 | 3300042591 | Bacteria | 4467 |
| 70 | Ga0466692_138796 | 3300042591 | Bacteria | 17805 |
| 71 | Ga0466694_066606 | 3300042594 | Bacteria | 3915 |
| 72 | Ga0466712_040190 | 3300042614 | Unclassified | 6840 |
| 73 | Ga0466712_053030 | 3300042614 | Bacteria | 13324 |
| 74 | 2211957656 | 2209111004 | Bacteria | 8543 |
| 75 | JGI24698J34947_10002228 | 3300002449 | Bacteria | 10386 |
| 76 | Ga0063521_1000146 | 3300003973 | Bacteria | 53228 |
| 77 | Ga0104045_1000043 | 3300007085 | Bacteria | 50340 |
| 78 | Ga0104048_1001670 | 3300007143 | Bacteria | 13032 |
| 79 | Ga0160469_100001 | 3300012824 | Bacteria | 1115787 |
| 80 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 81 | Ga0466692_075180 | 3300042591 | Bacteria | 26895 |
| 82 | Ga0466712_185215 | 3300042614 | Bacteria | 17545 |
| 83 | Ga0123355_10000016 | 3300009826 | Bacteria | 163334 |
| 84 | Ga0466707_064600 | 3300042601 | Bacteria | 2867 |
| 85 | Ga0466720_185331 | 3300042607 | Bacteria | 80374 |
| 86 | Ga0466724_56819 | 3300042649 | Bacteria | 199566 |
| 87 | JGI24698J34947_10001012 | 3300002449 | Bacteria | 14451 |
| 88 | CVPL010W_10000001 | 3300002931 | Bacteria | 135542 |
| 89 | Ga0072941_1011371 | 3300005201 | Bacteria | 34764 |
| 90 | Ga0072941_1012977 | 3300005201 | Bacteria | 17127 |
| 91 | Ga0264413_103442 | 3300024493 | Bacteria | 18937 |
| 92 | Ga0466694_274911 | 3300042594 | Bacteria | 15471 |
| 93 | Ga0466729_085051 | 3300042621 | Bacteria | 1928 |
| 94 | Ga0466706_077120 | 3300042599 | Bacteria | 80581 |
| 95 | Ga0466706_288606 | 3300042599 | Bacteria | 39888 |
| 96 | Ga0466707_198504 | 3300042601 | Bacteria | 5345 |
| 97 | Ga0466707_204600 | 3300042601 | Unclassified | 1340 |
| 98 | Ga0466707_386338 | 3300042601 | Bacteria | 3499 |
| 99 | Ga0466713_052636 | 3300042602 | Bacteria | 27053 |
| 100 | Ga0466714_118225 | 3300042603 | Bacteria | 20677 |
| 101 | Ga0466720_048242 | 3300042607 | Bacteria | 43364 |
| 102 | Ga0466734_065983 | 3300042623 | Bacteria | 25275 |
| 103 | Ga0466704_287526 | 3300042643 | Bacteria | 40864 |
| 104 | Ga0466704_494301 | 3300042643 | Bacteria | 2763 |
| 105 | Ga0466727_014784 | 3300042655 | Bacteria | 3484 |
| 106 | Ga0466727_178847 | 3300042655 | Bacteria | 3081 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.