Protein Family IF00279
Metagenome
Isolate
215
Members
70
Samples
198
Scaffolds
289.79
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1002761|AustNasuHG_10027612
- Length
- 337 aa
- Sequence
- MSLKILFFFLTYGIYIKCYKILLSIIKKEAVDMKNGTFSATAAVTTTVITALMLSSCADKPAEYDASGVFEATEVIVSARAGGELMEFNAEEGQTVEAGKPLGYIDTTQLYLQKMQLSANLKSVESRQRNVSKQVAPLYQQMAALQVDQKRFEKLTQSGAATQKQLDDVNAQIAVLEKQLTAQTETLVSGNRGVSGDSAGLSMQIAQITDQIHKCVIVSPIDGVVLSKYAQRGEWAVMGKNLFKVADISKMELRVYVTAGQLTSLKIGQSVKVYADRGKSDRAEYAGTVVWISDKAEFTPKTIQTRDERANLVYAVKIAVRNDGYIKRGMYGEIKI*
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.2%
Kalotermitidae
17.6%
Unclassified
14.7%
Rhinotermitidae
8.8%
Termopsidae
5.9%
Blattidae
5.9%
Hydrophilidae
2.9%
Passalidae
2.9%
Apidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
1
Bacteria
199
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 17 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 18 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 21 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 26 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 30 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 58 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 63 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 64 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 65 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 66 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 69 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 70 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_169845 | 3300042656 | Bacteria | 2169 |
| 2 | Ga0466733_017489 | 3300042659 | Bacteria | 155887 |
| 3 | Ga0466733_061316 | 3300042659 | Bacteria | 145079 |
| 4 | Ga0466733_142671 | 3300042659 | Bacteria | 6688 |
| 5 | Ga0466733_200104 | 3300042659 | Bacteria | 5462 |
| 6 | 2227485472 | 2225789004 | Unclassified | 4268 |
| 7 | IMNBL1DRAFT_c0000583 | 3300000062 | Bacteria | 29392 |
| 8 | JGI24699J35502_11133826 | 3300002509 | Bacteria | 16682 |
| 9 | JGI24696J40584_12960366 | 3300002834 | Bacteria | 7030 |
| 10 | Ga0466715_250172 | 3300042616 | Bacteria | 45297 |
| 11 | Ga0466715_364435 | 3300042616 | Bacteria | 27534 |
| 12 | Ga0466735_016995 | 3300042624 | Bacteria | 4549 |
| 13 | Ga0466730_075686 | 3300042625 | Bacteria | 6729 |
| 14 | Ga0466703_139456 | 3300042636 | Bacteria | 13307 |
| 15 | Ga0466709_188269 | 3300042648 | Bacteria | 23900 |
| 16 | Ga0466709_294434 | 3300042648 | Bacteria | 15301 |
| 17 | Ga0466692_094436 | 3300042591 | Bacteria | 13419 |
| 18 | Ga0466691_103305 | 3300042593 | Bacteria | 4938 |
| 19 | Ga0466694_108236 | 3300042594 | Bacteria | 1200 |
| 20 | Ga0466694_215933 | 3300042594 | Bacteria | 5210 |
| 21 | Ga0123354_10028812 | 3300010882 | Bacteria | 8742 |
| 22 | Ga0466701_102463 | 3300042598 | Bacteria | 1821 |
| 23 | Ga0466700_126678 | 3300042600 | Bacteria | 10654 |
| 24 | Ga0466713_111896 | 3300042602 | Bacteria | 1559 |
| 25 | Ga0466716_205093 | 3300042605 | Bacteria | 9610 |
| 26 | 2227619074 | 2225789004 | Bacteria | 11843 |
| 27 | IMNBL1DRAFT_c0005807 | 3300000062 | Bacteria | 6928 |
| 28 | IMNBL1DRAFT_c0016017 | 3300000062 | Bacteria | 3226 |
| 29 | HBC_ctgsDRAFT_1000007 | 3300000333 | Bacteria | 60444 |
| 30 | JGI24705J35276_12222248 | 3300002504 | Bacteria | 2405 |
| 31 | Ga0068305_10025754 | 3300005083 | Bacteria | 36192 |
| 32 | Ga0466711_212512 | 3300042615 | Bacteria | 3674 |
| 33 | Ga0466715_362242 | 3300042616 | Bacteria | 4250 |
| 34 | Ga0466723_107017 | 3300042618 | Bacteria | 6456 |
| 35 | Ga0466723_174605 | 3300042618 | Bacteria | 30587 |
| 36 | Ga0466734_125278 | 3300042623 | Bacteria | 2079 |
| 37 | Ga0466735_199145 | 3300042624 | Bacteria | 4563 |
| 38 | Ga0466708_226989 | 3300042652 | Bacteria | 13900 |
| 39 | Ga0265387_1000476 | 3300024582 | Bacteria | 6352 |
| 40 | Ga0466690_223491 | 3300042590 | Bacteria | 5800 |
| 41 | Ga0466693_222200 | 3300042592 | Bacteria | 4081 |
| 42 | Ga0466693_354191 | 3300042592 | Bacteria | 2111 |
| 43 | Ga0466696_089248 | 3300042596 | Bacteria | 20070 |
| 44 | Ga0123356_10023735 | 3300010049 | Bacteria | 5771 |
| 45 | Ga0123356_10701757 | 3300010049 | Bacteria | 1181 |
| 46 | Ga0123353_10239206 | 3300010167 | Bacteria | 2822 |
| 47 | Ga0123354_10265356 | 3300010882 | Unclassified | 1703 |
| 48 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 49 | Ga0466722_028721 | 3300042609 | Bacteria | 19694 |
| 50 | Ga0466722_242166 | 3300042609 | Bacteria | 9162 |
| 51 | Ga0466697_209636 | 3300042611 | Bacteria | 1069 |
| 52 | 2227330803 | 2225789004 | Bacteria | 6327 |
| 53 | JGI24702J35022_10015405 | 3300002462 | Bacteria | 4209 |
| 54 | JGI24702J35022_10050131 | 3300002462 | Bacteria | 2224 |
| 55 | Ga0466715_044215 | 3300042616 | Bacteria | 5744 |
| 56 | Ga0466728_064123 | 3300042620 | Bacteria | 12653 |
| 57 | Ga0466735_035547 | 3300042624 | Bacteria | 9380 |
| 58 | Ga0466735_227459 | 3300042624 | Unclassified | 2111 |
| 59 | Ga0466704_073764 | 3300042643 | Bacteria | 58999 |
| 60 | Ga0466709_267137 | 3300042648 | Bacteria | 107484 |
| 61 | Ga0466709_319231 | 3300042648 | Bacteria | 9287 |
| 62 | Ga0466727_114980 | 3300042655 | Bacteria | 11978 |
| 63 | Ga0466727_175033 | 3300042655 | Bacteria | 1712 |
| 64 | Ga0466690_112170 | 3300042590 | Unclassified | 1102 |
| 65 | Ga0123355_10694894 | 3300009826 | Bacteria | 1170 |
| 66 | Ga0123353_10200396 | 3300010167 | Bacteria | 3141 |
| 67 | Ga0123353_10347512 | 3300010167 | Bacteria | 2237 |
| 68 | Ga0123353_10627118 | 3300010167 | Bacteria | 1529 |
| 69 | Ga0466713_115952 | 3300042602 | Bacteria | 49145 |
| 70 | Ga0466713_145607 | 3300042602 | Bacteria | 14033 |
| 71 | Ga0466714_155905 | 3300042603 | Bacteria | 1196 |
| 72 | Ga0466717_048879 | 3300042604 | Bacteria | 1284 |
| 73 | Ga0466717_179510 | 3300042604 | Bacteria | 1165 |
| 74 | Ga0466697_235989 | 3300042611 | Bacteria | 1195 |
| 75 | 2227488535 | 2225789004 | Bacteria | 20704 |
| 76 | JGI24702J35022_10175670 | 3300002462 | Bacteria | 1214 |
| 77 | JGI24705J35276_12237684 | 3300002504 | Bacteria | 12536 |
| 78 | Ga0466711_278138 | 3300042615 | Bacteria | 50350 |
| 79 | Ga0466715_064087 | 3300042616 | Bacteria | 16716 |
| 80 | Ga0466734_166935 | 3300042623 | Bacteria | 2461 |
| 81 | Ga0466735_170139 | 3300042624 | Unclassified | 1539 |
| 82 | Ga0466703_055383 | 3300042636 | Bacteria | 2150 |
| 83 | Ga0466709_169084 | 3300042648 | Bacteria | 6041 |
| 84 | Ga0466725_159545 | 3300042654 | Bacteria | 14536 |
| 85 | Ga0466727_149247 | 3300042655 | Bacteria | 12138 |
| 86 | Ga0466692_085334 | 3300042591 | Bacteria | 19137 |
| 87 | Ga0466692_172057 | 3300042591 | Bacteria | 6432 |
| 88 | Ga0466691_121249 | 3300042593 | Bacteria | 23641 |
| 89 | Ga0466696_126604 | 3300042596 | Bacteria | 9916 |
| 90 | Ga0466696_127114 | 3300042596 | Bacteria | 4174 |
| 91 | Ga0466699_280403 | 3300042597 | Unclassified | 1703 |
| 92 | Ga0123353_10668754 | 3300010167 | Bacteria | 1466 |
| 93 | Ga0123354_10006986 | 3300010882 | Bacteria | 16875 |
| 94 | Ga0123354_10130671 | 3300010882 | Unclassified | 3174 |
| 95 | Ga0123354_10333449 | 3300010882 | Bacteria | 1379 |
| 96 | Ga0123354_10432833 | 3300010882 | Bacteria | 1082 |
| 97 | Ga0466714_038221 | 3300042603 | Bacteria | 5959 |
| 98 | Ga0466714_158208 | 3300042603 | Bacteria | 17679 |
| 99 | Ga0466716_110951 | 3300042605 | Bacteria | 9798 |
| 100 | Ga0466716_479804 | 3300042605 | Bacteria | 3822 |
| 101 | Ga0466697_028757 | 3300042611 | Bacteria | 1324 |
| 102 | Ga0466733_068617 | 3300042659 | Bacteria | 15208 |
| 103 | 2227111377 | 2225789004 | Bacteria | 9406 |
| 104 | IMNBL1DRAFT_c0002871 | 3300000062 | Bacteria | 11556 |
| 105 | Ga0068305_10008970 | 3300005083 | Bacteria | 3003 |
| 106 | Ga0466711_482136 | 3300042615 | Bacteria | 10780 |
| 107 | Ga0466715_142828 | 3300042616 | Bacteria | 10333 |
| 108 | Ga0466715_272177 | 3300042616 | Bacteria | 11341 |
| 109 | Ga0466723_298414 | 3300042618 | Bacteria | 7117 |
| 110 | Ga0466728_070388 | 3300042620 | Bacteria | 31051 |
| 111 | Ga0466728_084495 | 3300042620 | Bacteria | 23172 |
| 112 | Ga0466729_000798 | 3300042621 | Unclassified | 2173 |
| 113 | Ga0466735_195577 | 3300042624 | Bacteria | 2010 |
| 114 | Ga0466709_079566 | 3300042648 | Bacteria | 73471 |
| 115 | Ga0466708_016639 | 3300042652 | Bacteria | 1182 |
| 116 | Ga0466708_223604 | 3300042652 | Bacteria | 36867 |
| 117 | Ga0466708_365380 | 3300042652 | Bacteria | 7118 |
| 118 | Ga0265387_1004084 | 3300024582 | Bacteria | 1998 |
| 119 | Ga0265387_1005256 | 3300024582 | Bacteria | 1749 |
| 120 | Ga0466690_276540 | 3300042590 | Bacteria | 17132 |
| 121 | Ga0466690_392245 | 3300042590 | Bacteria | 8094 |
| 122 | Ga0466694_015412 | 3300042594 | Bacteria | 39546 |
| 123 | Ga0466696_008458 | 3300042596 | Bacteria | 7299 |
| 124 | Ga0466696_122457 | 3300042596 | Bacteria | 8783 |
| 125 | Ga0123353_10659871 | 3300010167 | Bacteria | 1478 |
| 126 | Ga0466706_141548 | 3300042599 | Bacteria | 1274 |
| 127 | Ga0466700_323570 | 3300042600 | Bacteria | 8727 |
| 128 | Ga0466713_035843 | 3300042602 | Bacteria | 2757 |
| 129 | Ga0466714_140845 | 3300042603 | Bacteria | 6113 |
| 130 | Ga0466720_204759 | 3300042607 | Bacteria | 1233 |
| 131 | Ga0466732_069268 | 3300042656 | Bacteria | 4432 |
| 132 | Ga0466733_029542 | 3300042659 | Bacteria | 4762 |
| 133 | Ga0466733_116566 | 3300042659 | Bacteria | 2476 |
| 134 | Ga0466733_168714 | 3300042659 | Bacteria | 8054 |
| 135 | IMNBL1DRAFT_c0000424 | 3300000062 | Bacteria | 35477 |
| 136 | JGI24696J40584_12961710 | 3300002834 | Bacteria | 45969 |
| 137 | Ga0466711_153064 | 3300042615 | Bacteria | 3530 |
| 138 | Ga0466726_366172 | 3300042619 | Bacteria | 6774 |
| 139 | Ga0466731_057511 | 3300042622 | Bacteria | 1162 |
| 140 | Ga0466731_100936 | 3300042622 | Bacteria | 28633 |
| 141 | Ga0466734_156614 | 3300042623 | Bacteria | 2299 |
| 142 | Ga0466735_038878 | 3300042624 | Bacteria | 9914 |
| 143 | Ga0466735_063121 | 3300042624 | Bacteria | 4591 |
| 144 | Ga0466704_099523 | 3300042643 | Bacteria | 24357 |
| 145 | Ga0466704_362607 | 3300042643 | Unclassified | 13489 |
| 146 | Ga0264413_100226 | 3300024493 | Unclassified | 18341 |
| 147 | Ga0466691_018011 | 3300042593 | Bacteria | 7805 |
| 148 | Ga0466696_069715 | 3300042596 | Bacteria | 52641 |
| 149 | Ga0466699_286992 | 3300042597 | Bacteria | 1040 |
| 150 | Ga0123355_10283287 | 3300009826 | Bacteria | 2285 |
| 151 | Ga0123353_10725587 | 3300010167 | Unclassified | 1389 |
| 152 | Ga0123354_10000296 | 3300010882 | Bacteria | 45682 |
| 153 | Ga0123354_10143902 | 3300010882 | Bacteria | 2931 |
| 154 | Ga0466701_018845 | 3300042598 | Bacteria | 3209 |
| 155 | Ga0466714_145430 | 3300042603 | Bacteria | 5068 |
| 156 | Ga0466732_392619 | 3300042656 | Bacteria | 3125 |
| 157 | IMNBL1DRAFT_c0004989 | 3300000062 | Bacteria | 7745 |
| 158 | AustNasuHG_c1002761 | 3300000089 | Bacteria | 6333 |
| 159 | Ga0068305_10051613 | 3300005083 | Bacteria | 3464 |
| 160 | Ga0068305_10495014 | 3300005083 | Bacteria | 1192 |
| 161 | Ga0466715_109248 | 3300042616 | Bacteria | 11266 |
| 162 | Ga0466715_348457 | 3300042616 | Bacteria | 3037 |
| 163 | Ga0466723_075018 | 3300042618 | Bacteria | 14744 |
| 164 | Ga0466728_031713 | 3300042620 | Bacteria | 34312 |
| 165 | Ga0466734_083741 | 3300042623 | Bacteria | 1698 |
| 166 | Ga0466709_339761 | 3300042648 | Bacteria | 5944 |
| 167 | Ga0466708_050850 | 3300042652 | Bacteria | 4037 |
| 168 | Ga0264413_110962 | 3300024493 | Bacteria | 11168 |
| 169 | Ga0466690_186066 | 3300042590 | Bacteria | 4983 |
| 170 | Ga0466692_016435 | 3300042591 | Bacteria | 18396 |
| 171 | Ga0466691_055506 | 3300042593 | Bacteria | 13103 |
| 172 | Ga0466695_018475 | 3300042595 | Bacteria | 3300 |
| 173 | Ga0466696_362740 | 3300042596 | Bacteria | 21961 |
| 174 | Ga0123357_10375432 | 3300009784 | Bacteria | 1327 |
| 175 | Ga0123356_10560116 | 3300010049 | Bacteria | 1305 |
| 176 | Ga0123353_10311415 | 3300010167 | Bacteria | 2396 |
| 177 | Ga0123353_10688706 | 3300010167 | Unclassified | 1438 |
| 178 | Ga0466701_023933 | 3300042598 | Bacteria | 19109 |
| 179 | Ga0466707_070387 | 3300042601 | Bacteria | 5867 |
| 180 | Ga0466707_124976 | 3300042601 | Unclassified | 1277 |
| 181 | Ga0466716_393792 | 3300042605 | Bacteria | 4397 |
| 182 | Ga0466722_050793 | 3300042609 | Bacteria | 19625 |
| 183 | Ga0466733_158505 | 3300042659 | Bacteria | 36594 |
| 184 | Ga0466733_173893 | 3300042659 | Bacteria | 19442 |
| 185 | IMNBL1DRAFT_c0002078 | 3300000062 | Bacteria | 14267 |
| 186 | JGI24702J35022_10001239 | 3300002462 | Bacteria | 15918 |
| 187 | Ga0068302_10196227 | 3300005071 | Bacteria | 1893 |
| 188 | Ga0466726_304617 | 3300042619 | Bacteria | 2031 |
| 189 | Ga0466735_144067 | 3300042624 | Archaea | 1043 |
| 190 | Ga0466735_158974 | 3300042624 | Unclassified | 1054 |
| 191 | Ga0466735_176993 | 3300042624 | Bacteria | 1671 |
| 192 | Ga0466692_134985 | 3300042591 | Bacteria | 9265 |
| 193 | Ga0466692_149995 | 3300042591 | Unclassified | 2360 |
| 194 | Ga0466693_076689 | 3300042592 | Bacteria | 3440 |
| 195 | Ga0466696_295663 | 3300042596 | Bacteria | 20617 |
| 196 | Ga0123353_10090071 | 3300010167 | Bacteria | 4940 |
| 197 | Ga0466714_066308 | 3300042603 | Bacteria | 4709 |
| 198 | Ga0466716_189885 | 3300042605 | Bacteria | 2576 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042624 | Ga0466735_158974 | Ga0466735_158974_376_1044 | 222 |
| 2 | 3300042590 | Ga0466690_112170 | Ga0466690_112170_18_701 | 227 |
| 3 | 3300042652 | Ga0466708_050850 | Ga0466708_050850_1830_2753 | 254 |
| 4 | 3300042624 | Ga0466735_195577 | Ga0466735_195577_187_1047 | 258 |
| 5 | 3300042595 | Ga0466695_018475 | Ga0466695_018475_1387_2286 | 269 |
| 6 | 3300002462 | JGI24702J35022_10175670 | JGI24702J35022_101756702 | 270 |
| 7 | 3300042616 | Ga0466715_362242 | Ga0466715_362242_1229_2125 | 270 |
| 8 | 3300042623 | Ga0466734_083741 | Ga0466734_083741_353_1252 | 270 |
| 9 | 3300042596 | Ga0466696_362740 | Ga0466696_362740_8094_9044 | 271 |
| 10 | 3300042603 | Ga0466714_038221 | Ga0466714_038221_1357_2277 | 271 |
| 11 | 3300042616 | Ga0466715_272177 | Ga0466715_272177_2672_3574 | 271 |
| 12 | 3300009826 | Ga0123355_10283287 | Ga0123355_102832872 | 272 |
| 13 | 3300042615 | Ga0466711_153064 | Ga0466711_153064_2185_3081 | 272 |
| 14 | 3300042618 | Ga0466723_075018 | Ga0466723_075018_7935_8873 | 272 |
| 15 | 3300042656 | Ga0466732_392619 | Ga0466732_392619_423_1331 | 272 |
| 16 | 3300042590 | Ga0466690_223491 | Ga0466690_223491_1568_2470 | 273 |
| 17 | 3300042655 | Ga0466727_114980 | Ga0466727_114980_9430_10332 | 273 |
| 18 | 3300010167 | Ga0123353_10668754 | Ga0123353_106687542 | 274 |
| 19 | 3300010167 | Ga0123353_10688706 | Ga0123353_106887061 | 274 |
| 20 | 3300042591 | Ga0466692_134985 | Ga0466692_134985_3180_4103 | 274 |
| 21 | 3300042593 | Ga0466691_018011 | Ga0466691_018011_2569_3471 | 274 |
| 22 | 3300042596 | Ga0466696_089248 | Ga0466696_089248_13863_14783 | 274 |
| 23 | 3300042604 | Ga0466717_048879 | Ga0466717_048879_146_1066 | 274 |
| 24 | 3300042609 | Ga0466722_242166 | Ga0466722_242166_4417_5319 | 274 |
| 25 | 3300042652 | Ga0466708_016639 | Ga0466708_016639_132_1028 | 274 |
| 26 | 3300042659 | Ga0466733_168714 | Ga0466733_168714_5626_6534 | 274 |
| 27 | 3300042596 | Ga0466696_295663 | Ga0466696_295663_19024_19926 | 275 |
| 28 | 3300042597 | Ga0466699_280403 | Ga0466699_280403_789_1676 | 275 |
| 29 | 3300042598 | Ga0466701_018845 | Ga0466701_018845_2169_3074 | 275 |
| 30 | 3300042623 | Ga0466734_125278 | Ga0466734_125278_868_1863 | 275 |
| 31 | 3300042648 | Ga0466709_188269 | Ga0466709_188269_6840_7739 | 275 |
| 32 | 3300010167 | Ga0123353_10090071 | Ga0123353_100900712 | 276 |
| 33 | 3300010882 | Ga0123354_10130671 | Ga0123354_101306712 | 276 |
| 34 | 3300042596 | Ga0466696_126604 | Ga0466696_126604_5418_6362 | 276 |
| 35 | 3300042654 | Ga0466725_159545 | Ga0466725_159545_5701_6612 | 276 |
| 36 | 3300042656 | Ga0466732_169845 | Ga0466732_169845_1216_2109 | 276 |
| 37 | 3300042659 | Ga0466733_200104 | Ga0466733_200104_1726_2634 | 276 |
| 38 | 3300009784 | Ga0123357_10375432 | Ga0123357_103754321 | 277 |
| 39 | 3300010167 | Ga0123353_10725587 | Ga0123353_107255872 | 277 |
| 40 | 3300042605 | Ga0466716_110951 | Ga0466716_110951_7796_8683 | 277 |
| 41 | 3300042607 | Ga0466720_204759 | Ga0466720_204759_188_1078 | 277 |
| 42 | 3300042620 | Ga0466728_064123 | Ga0466728_064123_4358_5275 | 277 |
| 43 | 3300042622 | Ga0466731_057511 | Ga0466731_057511_147_1094 | 277 |
| 44 | 3300010049 | Ga0123356_10023735 | Ga0123356_100237351 | 278 |
| 45 | 3300024493 | Ga0264413_100226 | Ga0264413_1002268 | 278 |
| 46 | 3300042599 | Ga0466706_141548 | Ga0466706_141548_398_1234 | 278 |
| 47 | 3300042605 | Ga0466716_479804 | Ga0466716_479804_1472_2371 | 278 |
| 48 | 3300042618 | Ga0466723_107017 | Ga0466723_107017_1405_2382 | 278 |
| 49 | 3300042590 | Ga0466690_276540 | Ga0466690_276540_12345_13241 | 279 |
| 50 | 3300042591 | Ga0466692_094436 | Ga0466692_094436_301_1221 | 279 |
| 51 | 3300042602 | Ga0466713_111896 | Ga0466713_111896_506_1447 | 279 |
| 52 | 3300042611 | Ga0466697_028757 | Ga0466697_028757_42_950 | 279 |
| 53 | 3300042616 | Ga0466715_250172 | Ga0466715_250172_3598_4437 | 279 |
| 54 | 3300042620 | Ga0466728_084495 | Ga0466728_084495_15055_15936 | 279 |
| 55 | 3300042616 | Ga0466715_044215 | Ga0466715_044215_3117_4073 | 280 |
| 56 | 3300042621 | Ga0466729_000798 | Ga0466729_000798_241_1134 | 280 |
| 57 | 3300000062 | IMNBL1DRAFT_c0000583 | IMNBL1DRAFT_00005835 | 281 |
| 58 | 3300024493 | Ga0264413_110962 | Ga0264413_1109627 | 281 |
| 59 | 3300042590 | Ga0466690_392245 | Ga0466690_392245_5557_6459 | 281 |
| 60 | 3300042602 | Ga0466713_143155 | Ga0466713_143155_89413_90312 | 281 |
| 61 | 3300042648 | Ga0466709_079566 | Ga0466709_079566_42923_43822 | 281 |
| 62 | 3300042652 | Ga0466708_226989 | Ga0466708_226989_7371_8267 | 281 |
| 63 | 3300002462 | JGI24702J35022_10001239 | JGI24702J35022_100012399 | 282 |
| 64 | 3300042592 | Ga0466693_076689 | Ga0466693_076689_629_1573 | 282 |
| 65 | 3300042594 | Ga0466694_108236 | Ga0466694_108236_257_1147 | 282 |
| 66 | 3300042594 | Ga0466694_215933 | Ga0466694_215933_4050_4934 | 282 |
| 67 | 3300042615 | Ga0466711_482136 | Ga0466711_482136_7514_8464 | 282 |
| 68 | 3300042659 | Ga0466733_173893 | Ga0466733_173893_9472_10380 | 282 |
| 69 | 3300002462 | JGI24702J35022_10015405 | JGI24702J35022_100154052 | 283 |
| 70 | 3300010167 | Ga0123353_10347512 | Ga0123353_103475122 | 283 |
| 71 | 3300042623 | Ga0466734_166935 | Ga0466734_166935_914_1795 | 283 |
| 72 | 3300042624 | Ga0466735_035547 | Ga0466735_035547_2076_2981 | 283 |
| 73 | 2225789004 | 2227619074 | 2228196647 | 284 |
| 74 | 3300002834 | JGI24696J40584_12961710 | JGI24696J40584_129617104 | 284 |
| 75 | 3300010049 | Ga0123356_10560116 | Ga0123356_105601162 | 284 |
| 76 | 3300042624 | Ga0466735_063121 | Ga0466735_063121_1119_2021 | 284 |
| 77 | 3300042656 | Ga0466732_069268 | Ga0466732_069268_1587_2486 | 284 |
| 78 | 2225789004 | 2227330803 | 2227778873 | 285 |
| 79 | 3300042594 | Ga0466694_015412 | Ga0466694_015412_6041_6988 | 285 |
| 80 | 3300042596 | Ga0466696_069715 | Ga0466696_069715_25573_26541 | 285 |
| 81 | 3300042609 | Ga0466722_028721 | Ga0466722_028721_7557_8453 | 285 |
| 82 | 3300042611 | Ga0466697_209636 | Ga0466697_209636_54_1001 | 285 |
| 83 | 3300042622 | Ga0466731_100936 | Ga0466731_100936_19002_19895 | 285 |
| 84 | 3300042659 | Ga0466733_116566 | Ga0466733_116566_292_1149 | 285 |
| 85 | 3300010882 | Ga0123354_10432833 | Ga0123354_104328331 | 286 |
| 86 | 3300042616 | Ga0466715_109248 | Ga0466715_109248_6885_7784 | 286 |
| 87 | 3300042616 | Ga0466715_142828 | Ga0466715_142828_2429_3388 | 286 |
| 88 | 3300042618 | Ga0466723_298414 | Ga0466723_298414_5507_6439 | 286 |
| 89 | 3300042624 | Ga0466735_227459 | Ga0466735_227459_1130_2008 | 286 |
| 90 | 3300005083 | Ga0068305_10051613 | Ga0068305_100516132 | 287 |
| 91 | 3300010167 | Ga0123353_10200396 | Ga0123353_102003961 | 287 |
| 92 | 3300042593 | Ga0466691_121249 | Ga0466691_121249_17571_18476 | 287 |
| 93 | 3300042602 | Ga0466713_035843 | Ga0466713_035843_1232_2131 | 287 |
| 94 | 3300042648 | Ga0466709_319231 | Ga0466709_319231_3906_4808 | 287 |
| 95 | 3300010167 | Ga0123353_10627118 | Ga0123353_106271182 | 288 |
| 96 | 3300042601 | Ga0466707_124976 | Ga0466707_124976_255_1121 | 288 |
| 97 | 3300042659 | Ga0466733_068617 | Ga0466733_068617_7133_7999 | 288 |
| 98 | 3300005083 | Ga0068305_10008970 | Ga0068305_100089704 | 289 |
| 99 | 3300042592 | Ga0466693_222200 | Ga0466693_222200_897_1850 | 289 |
| 100 | 3300042592 | Ga0466693_354191 | Ga0466693_354191_417_1367 | 289 |
| 101 | 3300042616 | Ga0466715_064087 | Ga0466715_064087_5773_6672 | 289 |
| 102 | 3300000062 | IMNBL1DRAFT_c0016017 | IMNBL1DRAFT_00160174 | 290 |
| 103 | 3300002504 | JGI24705J35276_12222248 | JGI24705J35276_122222483 | 290 |
| 104 | 3300042596 | Ga0466696_008458 | Ga0466696_008458_4119_5021 | 290 |
| 105 | 3300042598 | Ga0466701_102463 | Ga0466701_102463_461_1369 | 290 |
| 106 | 3300002509 | JGI24699J35502_11133826 | JGI24699J35502_111338268 | 291 |
| 107 | 3300042596 | Ga0466696_122457 | Ga0466696_122457_5667_6542 | 291 |
| 108 | 3300042603 | Ga0466714_066308 | Ga0466714_066308_1496_2443 | 291 |
| 109 | 3300042643 | Ga0466704_073764 | Ga0466704_073764_55739_56659 | 291 |
| 110 | 3300042652 | Ga0466708_365380 | Ga0466708_365380_4244_5143 | 291 |
| 111 | 3300000062 | IMNBL1DRAFT_c0000424 | IMNBL1DRAFT_000042415 | 292 |
| 112 | 3300024582 | Ga0265387_1000476 | Ga0265387_10004765 | 293 |
| 113 | 3300042618 | Ga0466723_174605 | Ga0466723_174605_10238_11203 | 293 |
| 114 | 3300042648 | Ga0466709_267137 | Ga0466709_267137_59166_60083 | 293 |
| 115 | 3300042655 | Ga0466727_149247 | Ga0466727_149247_8298_9266 | 293 |
| 116 | 3300000062 | IMNBL1DRAFT_c0004989 | IMNBL1DRAFT_00049896 | 294 |
| 117 | 3300042636 | Ga0466703_055383 | Ga0466703_055383_530_1429 | 294 |
| 118 | iso_pr_bacteria | 2820737921 | 2820738612 | 294 |
| 119 | 3300000333 | HBC_ctgsDRAFT_1000007 | HBC_ctgsDRAFT_100000752 | 296 |
| 120 | 3300042591 | Ga0466692_085334 | Ga0466692_085334_18096_18986 | 296 |
| 121 | 3300042591 | Ga0466692_172057 | Ga0466692_172057_4617_5507 | 296 |
| 122 | 3300042603 | Ga0466714_140845 | Ga0466714_140845_4001_4891 | 296 |
| 123 | 3300042603 | Ga0466714_145430 | Ga0466714_145430_3633_4523 | 296 |
| 124 | 3300042648 | Ga0466709_169084 | Ga0466709_169084_2873_3763 | 296 |
| 125 | 3300002834 | JGI24696J40584_12960366 | JGI24696J40584_129603664 | 297 |
| 126 | 3300024582 | Ga0265387_1005256 | Ga0265387_10052562 | 297 |
| 127 | 3300042591 | Ga0466692_016435 | Ga0466692_016435_5295_6218 | 297 |
| 128 | 3300042615 | Ga0466711_278138 | Ga0466711_278138_9363_10271 | 297 |
| 129 | 3300042619 | Ga0466726_366172 | Ga0466726_366172_1404_2318 | 297 |
| 130 | 3300042624 | Ga0466735_176993 | Ga0466735_176993_50_943 | 297 |
| 131 | 3300042655 | Ga0466727_175033 | Ga0466727_175033_270_1163 | 297 |
| 132 | iso_pr_bacteria | 2910930387 | 2910932665 | 297 |
| 133 | iso_pr_bacteria | 2940216256 | 2940216660 | 297 |
| 134 | 2225789004 | 2227485472 | 2227950863 | 298 |
| 135 | 3300042591 | Ga0466692_149995 | Ga0466692_149995_582_1478 | 298 |
| 136 | 3300042602 | Ga0466713_145607 | Ga0466713_145607_9721_10617 | 298 |
| 137 | 3300042609 | Ga0466722_050793 | Ga0466722_050793_18142_19038 | 298 |
| 138 | 3300042624 | Ga0466735_144067 | Ga0466735_144067_133_1029 | 298 |
| 139 | 3300042643 | Ga0466704_099523 | Ga0466704_099523_21255_22151 | 298 |
| 140 | 3300042648 | Ga0466709_294434 | Ga0466709_294434_5765_6661 | 298 |
| 141 | 3300042648 | Ga0466709_339761 | Ga0466709_339761_2656_3552 | 298 |
| 142 | 3300042659 | Ga0466733_142671 | Ga0466733_142671_472_1368 | 298 |
| 143 | iso_pr_bacteria | 2695420317 | 2695485717 | 298 |
| 144 | iso_pr_bacteria | 2967483437 | 2967487495 | 298 |
| 145 | iso_pr_bacteria | 3004667792 | 3004668856 | 298 |
| 146 | iso_pr_bacteria | 8100157865 | 8100158874 | 298 |
| 147 | 3300000062 | IMNBL1DRAFT_c0002871 | IMNBL1DRAFT_000287113 | 299 |
| 148 | 3300005083 | Ga0068305_10495014 | Ga0068305_104950142 | 299 |
| 149 | 3300010167 | Ga0123353_10659871 | Ga0123353_106598711 | 299 |
| 150 | 3300010882 | Ga0123354_10000296 | Ga0123354_1000029636 | 299 |
| 151 | 3300010882 | Ga0123354_10028812 | Ga0123354_100288128 | 299 |
| 152 | 3300010882 | Ga0123354_10143902 | Ga0123354_101439023 | 299 |
| 153 | 3300024582 | Ga0265387_1004084 | Ga0265387_10040842 | 299 |
| 154 | 3300042598 | Ga0466701_023933 | Ga0466701_023933_3327_4226 | 299 |
| 155 | 3300042602 | Ga0466713_115952 | Ga0466713_115952_43001_43900 | 299 |
| 156 | 3300042603 | Ga0466714_158208 | Ga0466714_158208_14031_14930 | 299 |
| 157 | 3300042605 | Ga0466716_393792 | Ga0466716_393792_2018_2917 | 299 |
| 158 | 3300042616 | Ga0466715_348457 | Ga0466715_348457_848_1846 | 299 |
| 159 | 3300042616 | Ga0466715_364435 | Ga0466715_364435_14522_15499 | 299 |
| 160 | 3300042619 | Ga0466726_304617 | Ga0466726_304617_885_1784 | 299 |
| 161 | 3300042643 | Ga0466704_362607 | Ga0466704_362607_10830_11729 | 299 |
| 162 | 3300042659 | Ga0466733_061316 | Ga0466733_061316_135379_136278 | 299 |
| 163 | 3300042659 | Ga0466733_158505 | Ga0466733_158505_22253_23152 | 299 |
| 164 | iso_pr_bacteria | 3004672520 | 3004676716 | 299 |
| 165 | iso_pr_bacteria | 8100166142 | 8100168601 | 299 |
| 166 | 3300000062 | IMNBL1DRAFT_c0002078 | IMNBL1DRAFT_000207811 | 300 |
| 167 | 3300005083 | Ga0068305_10025754 | Ga0068305_1002575410 | 300 |
| 168 | 3300010167 | Ga0123353_10239206 | Ga0123353_102392063 | 300 |
| 169 | 3300010167 | Ga0123353_10311415 | Ga0123353_103114153 | 300 |
| 170 | 3300010882 | Ga0123354_10265356 | Ga0123354_102653562 | 300 |
| 171 | 3300042623 | Ga0466734_156614 | Ga0466734_156614_79_981 | 300 |
| 172 | 3300042624 | Ga0466735_016995 | Ga0466735_016995_2976_3878 | 300 |
| 173 | 3300042624 | Ga0466735_170139 | Ga0466735_170139_79_981 | 300 |
| 174 | 3300042625 | Ga0466730_075686 | Ga0466730_075686_1446_2348 | 300 |
| 175 | 3300000062 | IMNBL1DRAFT_c0005807 | IMNBL1DRAFT_00058075 | 301 |
| 176 | 3300002462 | JGI24702J35022_10050131 | JGI24702J35022_100501312 | 301 |
| 177 | 3300009826 | Ga0123355_10694894 | Ga0123355_106948941 | 301 |
| 178 | 3300010882 | Ga0123354_10006986 | Ga0123354_1000698615 | 301 |
| 179 | 3300042604 | Ga0466717_179510 | Ga0466717_179510_194_1138 | 301 |
| 180 | 3300042615 | Ga0466711_212512 | Ga0466711_212512_763_1668 | 301 |
| 181 | 3300042659 | Ga0466733_029542 | Ga0466733_029542_1819_2724 | 301 |
| 182 | iso_pr_bacteria | 2609459943 | 2610742230 | 301 |
| 183 | iso_pr_bacteria | 2820748953 | 2820750022 | 301 |
| 184 | iso_pr_bacteria | 2830041218 | 2830044416 | 301 |
| 185 | iso_pr_bacteria | 2873600114 | 2873601923 | 301 |
| 186 | iso_pr_bacteria | 2873610414 | 2873612287 | 301 |
| 187 | 3300002504 | JGI24705J35276_12237684 | JGI24705J35276_122376848 | 302 |
| 188 | 3300042600 | Ga0466700_126678 | Ga0466700_126678_1011_1919 | 302 |
| 189 | 3300042605 | Ga0466716_189885 | Ga0466716_189885_1271_2179 | 302 |
| 190 | 3300042659 | Ga0466733_017489 | Ga0466733_017489_51928_52878 | 302 |
| 191 | 3300005071 | Ga0068302_10196227 | Ga0068302_101962272 | 303 |
| 192 | 3300042605 | Ga0466716_205093 | Ga0466716_205093_7402_8313 | 303 |
| 193 | 3300042624 | Ga0466735_038878 | Ga0466735_038878_6106_7017 | 303 |
| 194 | 3300042636 | Ga0466703_139456 | Ga0466703_139456_8414_9325 | 303 |
| 195 | iso_pr_bacteria | 2967483437 | 2967486206 | 303 |
| 196 | 3300042620 | Ga0466728_070388 | Ga0466728_070388_7314_8228 | 304 |
| 197 | 3300042652 | Ga0466708_223604 | Ga0466708_223604_32464_33378 | 304 |
| 198 | 3300042596 | Ga0466696_127114 | Ga0466696_127114_2076_3029 | 305 |
| 199 | 3300042597 | Ga0466699_286992 | Ga0466699_286992_110_1027 | 305 |
| 200 | 3300042611 | Ga0466697_235989 | Ga0466697_235989_10_927 | 305 |
| 201 | 3300042620 | Ga0466728_031713 | Ga0466728_031713_26646_27563 | 305 |
| 202 | 3300010049 | Ga0123356_10701757 | Ga0123356_107017571 | 306 |
| 203 | 3300042624 | Ga0466735_199145 | Ga0466735_199145_3058_3978 | 306 |
| 204 | 3300042603 | Ga0466714_155905 | Ga0466714_155905_248_1174 | 308 |
| 205 | 2225789004 | 2227488535 | 2227957805 | 309 |
| 206 | 3300042593 | Ga0466691_103305 | Ga0466691_103305_2050_2979 | 309 |
| 207 | 3300042590 | Ga0466690_186066 | Ga0466690_186066_1656_2588 | 310 |
| 208 | 3300042601 | Ga0466707_070387 | Ga0466707_070387_1787_2728 | 313 |
| 209 | 3300010882 | Ga0123354_10333449 | Ga0123354_103334492 | 315 |
| 210 | iso_pr_bacteria | 2820783511 | 2820785294 | 315 |
| 211 | 2225789004 | 2227111377 | 2227500379 | 316 |
| 212 | 3300042600 | Ga0466700_323570 | Ga0466700_323570_2147_3097 | 316 |
| 213 | iso_pr_bacteria | 2820762746 | 2820763324 | 318 |
| 214 | 3300042593 | Ga0466691_055506 | Ga0466691_055506_8444_9403 | 319 |
| 215 | 3300000089 | AustNasuHG_c1002761 | AustNasuHG_10027612 | 337 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.