Protein Family IF00256
Metagenome
Isolate
221
Members
81
Samples
212
Scaffolds
184.53
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0069138|IMNBL1DRAFT_00691382
- Length
- 205 aa
- Sequence
- LCLAEQWSLFTVCCINLEKIPKMSENIKKWYVLRAISGKEKKVKEYIENEVAQLKLQDYVSQVLIPTEKVYQIRSGKKISKERTFFPGYILIEAVLTGETPHILRNIPNVLGFLGSQDGEPVPLRKSEINRILGKVDELNASDEELNIPFFVGESVKVIDGPFVSFTGIIEEINEEKKKLKVMVKIFGRKTPLELSFMQVEKEN*
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Kalotermitidae
17.9%
Formicidae
10.3%
Unclassified
9.0%
Termopsidae
5.1%
Passalidae
3.8%
Armadillidiidae
3.8%
Rhinotermitidae
2.6%
Hodotermitidae
1.3%
Drosophilidae
1.3%
Tryonicidae
1.3%
Nephropidae
1.3%
Lamproblattidae
1.3%
Blattidae
1.3%
Aphididae
1.3%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 30 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 47 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 48 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 49 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 50 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 51 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 55 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 56 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 57 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 58 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 59 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 67 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 70 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 71 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 72 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 76 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 77 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 78 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 79 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 80 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 81 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_019794 | 3300042659 | Bacteria | 9549 |
| 2 | Ga0123356_10207791 | 3300010049 | Bacteria | 2003 |
| 3 | Ga0123356_10497128 | 3300010049 | Unclassified | 1375 |
| 4 | Ga0123353_10250099 | 3300010167 | Bacteria | 2746 |
| 5 | Ga0123353_10688783 | 3300010167 | Bacteria | 1437 |
| 6 | Ga0123354_10218929 | 3300010882 | Unclassified | 2030 |
| 7 | 2227005659 | 2225789003 | Bacteria | 1233 |
| 8 | JGI24695J34938_10216979 | 3300002450 | Bacteria | 802 |
| 9 | JGI24705J35276_12231309 | 3300002504 | Bacteria | 3900 |
| 10 | Ga0068305_10000815 | 3300005083 | Bacteria | 27082 |
| 11 | Ga0102739_1000113 | 3300007095 | Bacteria | 23232 |
| 12 | Ga0466705_401902 | 3300042612 | Bacteria | 6044 |
| 13 | Ga0466705_404549 | 3300042612 | Bacteria | 7310 |
| 14 | Ga0466710_240294 | 3300042613 | Bacteria | 1431 |
| 15 | Ga0466715_014869 | 3300042616 | Bacteria | 29478 |
| 16 | Ga0466715_152033 | 3300042616 | Bacteria | 6414 |
| 17 | Ga0466726_226024 | 3300042619 | Bacteria | 1365 |
| 18 | Ga0466707_352844 | 3300042601 | Bacteria | 26463 |
| 19 | Ga0466714_140200 | 3300042603 | Bacteria | 35773 |
| 20 | Ga0160445_126724 | 3300012847 | Unclassified | 727 |
| 21 | Ga0466729_238147 | 3300042621 | Unclassified | 5563 |
| 22 | Ga0466735_103523 | 3300042624 | Bacteria | 3690 |
| 23 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 24 | Ga0466704_011833 | 3300042643 | Unclassified | 1685 |
| 25 | Ga0466709_190184 | 3300042648 | Bacteria | 38440 |
| 26 | Ga0466697_072471 | 3300042611 | Bacteria | 1083 |
| 27 | Ga0466733_004607 | 3300042659 | Bacteria | 2756 |
| 28 | Ga0123356_10013608 | 3300010049 | Bacteria | 7842 |
| 29 | Ga0123356_10084074 | 3300010049 | Bacteria | 3016 |
| 30 | Ga0123356_11970174 | 3300010049 | Unclassified | 728 |
| 31 | Ga0123353_10822120 | 3300010167 | Unclassified | 1279 |
| 32 | Ga0123354_10220691 | 3300010882 | Unclassified | 2015 |
| 33 | Ga0123354_10528931 | 3300010882 | Bacteria | 901 |
| 34 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 35 | IMNBL1DRAFT_c0023386 | 3300000062 | Bacteria | 2421 |
| 36 | IMNBL1DRAFT_c0030774 | 3300000062 | Bacteria | 1962 |
| 37 | IMNBL1DRAFT_c0069138 | 3300000062 | Bacteria | 1026 |
| 38 | JGI24696J40584_12737808 | 3300002834 | Bacteria | 778 |
| 39 | Ga0103265_1000078 | 3300007068 | Bacteria | 14114 |
| 40 | Ga0103267_1000093 | 3300007190 | Bacteria | 34923 |
| 41 | Ga0466728_454406 | 3300042620 | Bacteria | 14071 |
| 42 | Ga0466701_081763 | 3300042598 | Bacteria | 1887 |
| 43 | Ga0466707_103272 | 3300042601 | Bacteria | 1073 |
| 44 | Ga0466719_030463 | 3300042606 | Bacteria | 1174 |
| 45 | Ga0466657_356593 | 3300042582 | Unclassified | 2093 |
| 46 | Ga0466694_241190 | 3300042594 | Unclassified | 1832 |
| 47 | Ga0466696_105560 | 3300042596 | Bacteria | 1364 |
| 48 | Ga0466734_097058 | 3300042623 | Bacteria | 1087 |
| 49 | Ga0466735_152957 | 3300042624 | Bacteria | 1771 |
| 50 | Ga0466703_056502 | 3300042636 | Bacteria | 16463 |
| 51 | Ga0466703_196755 | 3300042636 | Bacteria | 1724 |
| 52 | Ga0466704_202585 | 3300042643 | Bacteria | 23604 |
| 53 | Ga0466727_215359 | 3300042655 | Bacteria | 55489 |
| 54 | Ga0466727_342579 | 3300042655 | Bacteria | 1000 |
| 55 | Ga0466733_048785 | 3300042659 | Bacteria | 21900 |
| 56 | Ga0466733_185684 | 3300042659 | Bacteria | 3188 |
| 57 | Ga0123356_10050915 | 3300010049 | Bacteria | 3853 |
| 58 | Ga0123356_10409606 | 3300010049 | Bacteria | 1495 |
| 59 | Ga0123356_11038593 | 3300010049 | Bacteria | 989 |
| 60 | Ga0123353_10043937 | 3300010167 | Bacteria | 7081 |
| 61 | Ga0123354_10062052 | 3300010882 | Bacteria | 5508 |
| 62 | JGI24702J35022_10004403 | 3300002462 | Bacteria | 8363 |
| 63 | JGI24705J35276_12230167 | 3300002504 | Bacteria | 3559 |
| 64 | JGI24705J35276_12235773 | 3300002504 | Bacteria | 6966 |
| 65 | Ga0072941_1225249 | 3300005201 | Unclassified | 1328 |
| 66 | Ga0103268_1000172 | 3300007192 | Bacteria | 21394 |
| 67 | Ga0466705_404689 | 3300042612 | Bacteria | 7094 |
| 68 | Ga0466710_365056 | 3300042613 | Bacteria | 1372 |
| 69 | Ga0466711_458464 | 3300042615 | Bacteria | 2790 |
| 70 | Ga0466726_415216 | 3300042619 | Unclassified | 1701 |
| 71 | Ga0466706_240792 | 3300042599 | Bacteria | 18647 |
| 72 | Ga0466707_372898 | 3300042601 | Unclassified | 3377 |
| 73 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 74 | Ga0466714_037694 | 3300042603 | Bacteria | 1205 |
| 75 | Ga0466717_252114 | 3300042604 | Bacteria | 10471 |
| 76 | Ga0160445_114976 | 3300012847 | Unclassified | 1081 |
| 77 | Ga0466656_125946 | 3300042550 | Bacteria | 2546 |
| 78 | Ga0466692_127454 | 3300042591 | Bacteria | 1072 |
| 79 | Ga0466692_131466 | 3300042591 | Bacteria | 1970 |
| 80 | Ga0466735_221758 | 3300042624 | Bacteria | 6611 |
| 81 | Ga0466704_296153 | 3300042643 | Bacteria | 75272 |
| 82 | Ga0466704_363032 | 3300042643 | Bacteria | 24824 |
| 83 | Ga0466709_223017 | 3300042648 | Unclassified | 1835 |
| 84 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 85 | Ga0466697_250597 | 3300042611 | Bacteria | 2384 |
| 86 | Ga0123356_11694406 | 3300010049 | Unclassified | 784 |
| 87 | Ga0123353_10690600 | 3300010167 | Bacteria | 1435 |
| 88 | Ga0123353_10766770 | 3300010167 | Bacteria | 1339 |
| 89 | Ga0123353_10809288 | 3300010167 | Bacteria | 1292 |
| 90 | JGI24702J35022_10115389 | 3300002462 | Bacteria | 1479 |
| 91 | JGI24705J35276_12164875 | 3300002504 | Bacteria | 1254 |
| 92 | CVPL010W_10006115 | 3300002931 | Bacteria | 12518 |
| 93 | Ga0103268_1000292 | 3300007192 | Bacteria | 40849 |
| 94 | Ga0466729_149597 | 3300042621 | Bacteria | 2778 |
| 95 | Ga0466706_155952 | 3300042599 | Bacteria | 22107 |
| 96 | Ga0466698_336280 | 3300042610 | Bacteria | 1684 |
| 97 | Ga0264413_136611 | 3300024493 | Bacteria | 9290 |
| 98 | Ga0466690_035128 | 3300042590 | Bacteria | 21568 |
| 99 | Ga0466695_316896 | 3300042595 | Bacteria | 5066 |
| 100 | Ga0466696_437708 | 3300042596 | Bacteria | 5021 |
| 101 | Ga0466730_007760 | 3300042625 | Bacteria | 3753 |
| 102 | Ga0466733_133032 | 3300042659 | Bacteria | 1042 |
| 103 | Ga0123356_10118198 | 3300010049 | Bacteria | 2573 |
| 104 | Ga0123356_10130730 | 3300010049 | Bacteria | 2459 |
| 105 | Ga0123353_10002158 | 3300010167 | Bacteria | 24325 |
| 106 | Ga0123353_10198107 | 3300010167 | Bacteria | 3163 |
| 107 | Ga0123353_10349485 | 3300010167 | Bacteria | 2229 |
| 108 | Ga0123353_10543717 | 3300010167 | Unclassified | 1678 |
| 109 | Ga0123353_11620274 | 3300010167 | Bacteria | 816 |
| 110 | Ga0123354_10087187 | 3300010882 | Bacteria | 4356 |
| 111 | Ga0123354_10116419 | 3300010882 | Bacteria | 3486 |
| 112 | IMNBL1DRAFT_c0067485 | 3300000062 | Bacteria | 1046 |
| 113 | JGI24698J34947_10052165 | 3300002449 | Bacteria | 2053 |
| 114 | JGI24702J35022_10003371 | 3300002462 | Bacteria | 9649 |
| 115 | JGI24702J35022_10004002 | 3300002462 | Bacteria | 8839 |
| 116 | JGI24702J35022_10009093 | 3300002462 | Bacteria | 5595 |
| 117 | JGI24696J40584_12913921 | 3300002834 | Bacteria | 1280 |
| 118 | JGI24696J40584_12955735 | 3300002834 | Unclassified | 2912 |
| 119 | Ga0127649_100534 | 3300009460 | Bacteria | 84789 |
| 120 | Ga0466711_035701 | 3300042615 | Bacteria | 9190 |
| 121 | Ga0466715_320647 | 3300042616 | Bacteria | 41067 |
| 122 | Ga0466718_023592 | 3300042617 | Bacteria | 7502 |
| 123 | Ga0466723_087930 | 3300042618 | Unclassified | 12826 |
| 124 | Ga0466726_179627 | 3300042619 | Bacteria | 2779 |
| 125 | Ga0466706_216759 | 3300042599 | Bacteria | 37972 |
| 126 | Ga0466713_069048 | 3300042602 | Bacteria | 26937 |
| 127 | Ga0466716_043954 | 3300042605 | Bacteria | 10814 |
| 128 | Ga0466690_079526 | 3300042590 | Bacteria | 19077 |
| 129 | Ga0466699_106207 | 3300042597 | Bacteria | 3082 |
| 130 | Ga0466701_011778 | 3300042598 | Bacteria | 7311 |
| 131 | Ga0466731_155864 | 3300042622 | Bacteria | 1007 |
| 132 | Ga0466735_014378 | 3300042624 | Bacteria | 1848 |
| 133 | Ga0466704_052868 | 3300042643 | Bacteria | 16054 |
| 134 | Ga0466704_534458 | 3300042643 | Bacteria | 6960 |
| 135 | Ga0466727_050107 | 3300042655 | Bacteria | 1127 |
| 136 | Ga0466705_255517 | 3300042612 | Bacteria | 7635 |
| 137 | Ga0466733_010912 | 3300042659 | Bacteria | 47437 |
| 138 | Ga0123356_10184624 | 3300010049 | Bacteria | 2110 |
| 139 | Ga0123356_11370945 | 3300010049 | Bacteria | 868 |
| 140 | Ga0123353_10892387 | 3300010167 | Unclassified | 1212 |
| 141 | Ga0123353_11009387 | 3300010167 | Unclassified | 1117 |
| 142 | JGI24702J35022_10003774 | 3300002462 | Bacteria | 9104 |
| 143 | JGI24702J35022_10061393 | 3300002462 | Bacteria | 2011 |
| 144 | JGI24702J35022_10081981 | 3300002462 | Bacteria | 1748 |
| 145 | Ga0068302_10233563 | 3300005071 | Bacteria | 2446 |
| 146 | Ga0104045_1017182 | 3300007085 | Bacteria | 1668 |
| 147 | Ga0102740_1000259 | 3300007140 | Bacteria | 15017 |
| 148 | Ga0103267_1002999 | 3300007190 | Bacteria | 4428 |
| 149 | Ga0466705_448275 | 3300042612 | Bacteria | 17701 |
| 150 | Ga0466715_119678 | 3300042616 | Bacteria | 6351 |
| 151 | Ga0466723_360028 | 3300042618 | Bacteria | 13095 |
| 152 | Ga0466713_104757 | 3300042602 | Bacteria | 74823 |
| 153 | Ga0466698_187939 | 3300042610 | Bacteria | 3857 |
| 154 | Ga0466697_026175 | 3300042611 | Bacteria | 1021 |
| 155 | Ga0160468_100060 | 3300012819 | Bacteria | 151929 |
| 156 | Ga0160445_102044 | 3300012847 | Bacteria | 4956 |
| 157 | Ga0466696_408093 | 3300042596 | Bacteria | 3316 |
| 158 | Ga0466731_114425 | 3300042622 | Bacteria | 2101 |
| 159 | Ga0466735_047266 | 3300042624 | Bacteria | 1676 |
| 160 | Ga0466702_412698 | 3300042635 | Bacteria | 1187 |
| 161 | Ga0466709_197051 | 3300042648 | Unclassified | 3042 |
| 162 | Ga0466708_182354 | 3300042652 | Bacteria | 36083 |
| 163 | Ga0466727_279565 | 3300042655 | Bacteria | 1064 |
| 164 | Ga0123353_10001491 | 3300010167 | Bacteria | 28672 |
| 165 | Ga0123353_10060062 | 3300010167 | Bacteria | 6097 |
| 166 | Ga0123353_10368274 | 3300010167 | Bacteria | 2156 |
| 167 | Ga0123353_10478499 | 3300010167 | Unclassified | 1823 |
| 168 | Ga0123353_10558737 | 3300010167 | Bacteria | 1648 |
| 169 | Ga0123353_10763706 | 3300010167 | Unclassified | 1343 |
| 170 | Ga0123354_10431406 | 3300010882 | Unclassified | 1085 |
| 171 | IMNBL1DRAFT_c0001223 | 3300000062 | Bacteria | 19402 |
| 172 | Ga0072941_1202404 | 3300005201 | Bacteria | 2198 |
| 173 | Ga0072941_1421363 | 3300005201 | Bacteria | 2415 |
| 174 | Ga0102734_1000776 | 3300007129 | Bacteria | 8545 |
| 175 | Ga0102737_1000011 | 3300007142 | Bacteria | 58240 |
| 176 | Ga0103267_1000189 | 3300007190 | Bacteria | 24214 |
| 177 | Ga0466710_432372 | 3300042613 | Bacteria | 2106 |
| 178 | Ga0466712_156123 | 3300042614 | Bacteria | 2267 |
| 179 | Ga0466715_543115 | 3300042616 | Bacteria | 2752 |
| 180 | Ga0466726_484479 | 3300042619 | Bacteria | 6917 |
| 181 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 182 | Ga0466714_126608 | 3300042603 | Bacteria | 1353 |
| 183 | Ga0160457_1009056 | 3300012858 | Unclassified | 1429 |
| 184 | Ga0466690_218913 | 3300042590 | Unclassified | 6452 |
| 185 | Ga0466691_078749 | 3300042593 | Unclassified | 2349 |
| 186 | Ga0466729_282002 | 3300042621 | Bacteria | 21369 |
| 187 | Ga0466697_139815 | 3300042611 | Bacteria | 1285 |
| 188 | Ga0466733_010054 | 3300042659 | Bacteria | 17175 |
| 189 | Ga0123355_10778341 | 3300009826 | Unclassified | 1074 |
| 190 | Ga0123356_10349591 | 3300010049 | Bacteria | 1602 |
| 191 | Ga0123353_10220485 | 3300010167 | Unclassified | 2966 |
| 192 | Ga0123353_10254266 | 3300010167 | Bacteria | 2718 |
| 193 | Ga0123353_11206671 | 3300010167 | Bacteria | 992 |
| 194 | Ga0123354_10205207 | 3300010882 | Unclassified | 2151 |
| 195 | IMNBL1DRAFT_c0001671 | 3300000062 | Bacteria | 16384 |
| 196 | IMNBL1DRAFT_c0014312 | 3300000062 | Bacteria | 3508 |
| 197 | Ga0068302_10225876 | 3300005071 | Bacteria | 1249 |
| 198 | Ga0072940_1029376 | 3300005200 | Bacteria | 1960 |
| 199 | Ga0466712_305420 | 3300042614 | Bacteria | 1141 |
| 200 | Ga0466711_446956 | 3300042615 | Bacteria | 32910 |
| 201 | Ga0466700_411547 | 3300042600 | Bacteria | 3818 |
| 202 | Ga0466714_028666 | 3300042603 | Bacteria | 89946 |
| 203 | Ga0466714_084536 | 3300042603 | Bacteria | 52454 |
| 204 | Ga0466716_046773 | 3300042605 | Bacteria | 2436 |
| 205 | Ga0466697_027534 | 3300042611 | Bacteria | 2254 |
| 206 | Ga0466690_241545 | 3300042590 | Bacteria | 13899 |
| 207 | Ga0466693_066639 | 3300042592 | Bacteria | 1223 |
| 208 | Ga0466691_000897 | 3300042593 | Bacteria | 25654 |
| 209 | Ga0466691_055990 | 3300042593 | Bacteria | 16255 |
| 210 | Ga0466734_045418 | 3300042623 | Bacteria | 1299 |
| 211 | Ga0466735_117445 | 3300042624 | Bacteria | 1181 |
| 212 | Ga0466703_249168 | 3300042636 | Bacteria | 12929 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.