Protein Family IF00254
Metagenome
Isolate
387
Members
298
Samples
148
Scaffolds
172.55
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0045679|IMNBL1DRAFT_00456792
- Length
- 208 aa
- Sequence
- VRYLNEIYAFCCLKNTRKNDILLELSQIEGVEVMKKIEEYVRSIKDFPEEGIIFRDITSILEDADGLKLAVDLMQEKVENEEFDIVIGPESRGFIFGMPIAYNMHKAFVPIRKKGKLPCETVGIKYELEYGTAELELHRSAIKKGDKVVIIDDLMATGGTTEAMIQLIEGLGGIVVKIVFLIELKGLEGIKRLDGYQVESIISYEGK*
Sample Types
Isolate
61.8%
Metagenome
38.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.8%
Apidae
15.9%
Blattidae
10.8%
Drosophilidae
9.0%
Termitidae
7.9%
Scarabaeidae
3.6%
Halictidae
3.2%
Tenebrionidae
2.9%
Elmidae
2.5%
Kalotermitidae
2.5%
Pyralidae
2.2%
Formicidae
2.2%
Armadillidiidae
1.1%
Bombycidae
1.1%
Rhinotermitidae
1.1%
Dytiscidae
1.1%
Termopsidae
1.1%
Passalidae
1.1%
Noctuidae
0.7%
Culicidae
0.7%
Calliphoridae
0.4%
Vespidae
0.4%
Sarcophagidae
0.4%
Hodotermitidae
0.4%
Libellulidae
0.4%
Eresidae
0.4%
Euphausiidae
0.4%
Stratiomyidae
0.4%
Ocypodidae
0.4%
Gomphidae
0.4%
Nephropidae
0.4%
Portunidae
0.4%
Penaeidae
0.4%
Hydrophilidae
0.4%
Curculionidae
0.4%
Taxonomy
Archaea
0
Bacteria
363
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 3 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 4 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 5 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 6 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 7 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 8 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 9 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 10 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 11 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 12 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 13 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 14 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 15 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 16 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 17 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 18 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 19 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 20 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 21 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 22 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 23 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 24 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 25 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 26 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 27 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 28 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 29 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 30 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 31 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 32 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 33 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 34 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 35 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 36 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 37 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 42 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 43 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 44 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 45 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 46 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 47 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 48 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 49 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 50 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 54 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 55 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 56 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 57 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 58 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 59 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 60 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 61 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 62 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 63 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 64 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 65 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 66 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 67 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 68 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 69 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 70 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 71 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 72 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 73 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 74 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 75 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 76 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 77 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 78 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 79 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 80 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 81 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 82 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 83 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 84 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 85 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 86 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 87 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 88 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 89 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 90 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 91 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 92 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 93 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 94 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 95 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 96 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 97 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 98 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 99 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 100 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 101 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 102 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 103 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 104 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 105 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 106 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 107 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 108 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 109 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 110 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 111 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 112 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 113 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 114 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 115 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 116 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 117 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 118 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 119 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 120 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 121 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 122 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 123 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 124 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 125 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 126 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 127 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 128 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 129 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 130 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 131 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 132 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 133 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 134 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 135 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 136 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 137 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 138 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 139 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 140 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 141 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 142 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 143 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 144 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 145 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 146 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 147 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 148 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 149 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 150 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 151 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 152 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 153 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 154 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 155 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 156 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 157 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 158 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 159 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 160 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 161 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 162 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 163 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 164 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 165 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 166 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 167 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 168 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 169 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 170 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 171 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 172 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 173 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 174 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 175 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 176 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 177 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 178 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 179 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 180 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 181 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 182 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 183 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 184 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 185 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 186 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 187 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 188 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 189 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 190 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 191 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 192 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 193 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 194 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 195 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 196 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 197 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 198 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 199 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 200 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 201 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 202 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 203 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 204 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 205 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 206 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 207 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 208 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 209 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 210 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 211 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 212 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 213 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 214 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 215 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 216 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 217 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 218 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 219 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 220 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 221 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 222 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 223 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 224 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 225 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 226 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 227 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 228 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 229 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 230 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 231 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 232 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 233 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 234 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 235 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 236 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 237 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 238 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 239 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 240 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 241 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 242 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 243 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 244 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 245 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 246 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 247 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 248 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 249 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 250 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 251 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 252 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 253 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 254 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 255 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 256 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 257 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 258 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 259 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 260 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 261 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 262 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 263 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 264 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 265 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 266 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 267 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 268 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 269 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 270 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 271 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 272 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 273 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 274 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 275 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 276 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 277 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 278 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 279 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 280 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 281 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 282 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 283 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 284 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 285 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 286 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 287 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 288 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 289 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 290 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
| 291 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 292 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 293 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 294 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 295 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 296 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 297 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 298 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0234 | 3300056814 | Unclassified | 130023 |
| 2 | Ga0562374_0082 | 3300057007 | Unclassified | 284758 |
| 3 | Ga0562374_1124 | 3300057007 | Bacteria | 34534 |
| 4 | IMNBL1DRAFT_c0026799 | 3300000062 | Bacteria | 2182 |
| 5 | AustNasuHG_c1008064 | 3300000089 | Bacteria | 3733 |
| 6 | HBC_ctgsDRAFT_1046711 | 3300000333 | Unclassified | 1055 |
| 7 | JGI24703J35330_11747613 | 3300002501 | Bacteria | 7443 |
| 8 | JGI24703J35330_11747864 | 3300002501 | Bacteria | 8708 |
| 9 | Ga0466715_357572 | 3300042616 | Bacteria | 181743 |
| 10 | Ga0466715_589362 | 3300042616 | Bacteria | 11751 |
| 11 | Ga0466726_099829 | 3300042619 | Bacteria | 117568 |
| 12 | Ga0466727_057228 | 3300042655 | Bacteria | 28562 |
| 13 | Ga0123357_10124412 | 3300009784 | Bacteria | 3235 |
| 14 | Ga0123355_10515977 | 3300009826 | Bacteria | 1465 |
| 15 | Ga0123356_11408360 | 3300010049 | Bacteria | 857 |
| 16 | Ga0123353_10061193 | 3300010167 | Bacteria | 6037 |
| 17 | Ga0255576_1000001 | 3300026558 | Bacteria | 687723 |
| 18 | Ga0255575_1000007 | 3300026559 | Bacteria | 308135 |
| 19 | Ga0466706_245779 | 3300042599 | Bacteria | 3103 |
| 20 | Ga0466707_274249 | 3300042601 | Bacteria | 61467 |
| 21 | Ga0466707_353762 | 3300042601 | Bacteria | 3560 |
| 22 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 23 | Ga0562379_0275 | 3300056790 | Bacteria | 132969 |
| 24 | Ga0562379_0393 | 3300056790 | Bacteria | 98832 |
| 25 | Ga0562378_0096 | 3300056814 | Bacteria | 246586 |
| 26 | Ga0562378_1859 | 3300056814 | Bacteria | 20521 |
| 27 | Ga0562375_3099 | 3300056856 | Unclassified | 16553 |
| 28 | 2227512969 | 2225789004 | Unclassified | 3512 |
| 29 | HBC_ctgsDRAFT_1005941 | 3300000333 | Unclassified | 2868 |
| 30 | JGI24700J35501_10930144 | 3300002508 | Bacteria | 11696 |
| 31 | Ga0466715_199540 | 3300042616 | Bacteria | 144220 |
| 32 | Ga0466715_428250 | 3300042616 | Bacteria | 21415 |
| 33 | Ga0466709_147924 | 3300042648 | Bacteria | 39050 |
| 34 | Ga0123355_10207381 | 3300009826 | Bacteria | 2848 |
| 35 | Ga0123353_10026587 | 3300010167 | Bacteria | 8845 |
| 36 | Ga0123353_10700972 | 3300010167 | Bacteria | 1421 |
| 37 | Ga0160445_102567 | 3300012847 | Bacteria | 4112 |
| 38 | Ga0466700_301077 | 3300042600 | Bacteria | 28487 |
| 39 | Ga0466707_412451 | 3300042601 | Bacteria | 3315 |
| 40 | Ga0466713_052392 | 3300042602 | Bacteria | 216200 |
| 41 | Ga0466714_118011 | 3300042603 | Bacteria | 1074 |
| 42 | Ga0466722_067396 | 3300042609 | Bacteria | 1364 |
| 43 | Ga0466732_349506 | 3300042656 | Bacteria | 1826 |
| 44 | Ga0466733_070008 | 3300042659 | Bacteria | 50555 |
| 45 | IMNBL1DRAFT_c0058248 | 3300000062 | Bacteria | 1174 |
| 46 | Ga0072940_1290108 | 3300005200 | Bacteria | 914 |
| 47 | Ga0074278_102193 | 3300005721 | Bacteria | 17666 |
| 48 | Ga0074278_105617 | 3300005721 | Unclassified | 1640 |
| 49 | Ga0466709_044661 | 3300042648 | Bacteria | 1759 |
| 50 | Ga0123353_10019469 | 3300010167 | Unclassified | 10087 |
| 51 | Ga0160471_107834 | 3300012812 | Bacteria | 1273 |
| 52 | Ga0466706_009084 | 3300042599 | Bacteria | 5566 |
| 53 | Ga0466706_182763 | 3300042599 | Bacteria | 15291 |
| 54 | Ga0466713_072041 | 3300042602 | Bacteria | 94552 |
| 55 | Ga0466733_073226 | 3300042659 | Bacteria | 1841 |
| 56 | Ga0530661_001808 | 3300056564 | Unclassified | 9598 |
| 57 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 58 | Ga0562375_0742 | 3300056856 | Unclassified | 57376 |
| 59 | Ga0562376_0005 | 3300056857 | Bacteria | 2173693 |
| 60 | Ga0562376_0481 | 3300056857 | Bacteria | 72588 |
| 61 | Ga0562374_3603 | 3300057007 | Unclassified | 7787 |
| 62 | 2227364454 | 2225789004 | Bacteria | 1122 |
| 63 | 2227384418 | 2225789004 | Bacteria | 1095 |
| 64 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 65 | IMNBL1DRAFT_c0045679 | 3300000062 | Bacteria | 1428 |
| 66 | HBC_ctgsDRAFT_1000122 | 3300000333 | Bacteria | 18957 |
| 67 | HBC_ctgsDRAFT_1007123 | 3300000333 | Unclassified | 2630 |
| 68 | Ga0466710_228698 | 3300042613 | Bacteria | 1714 |
| 69 | Ga0466715_041286 | 3300042616 | Bacteria | 1963 |
| 70 | Ga0466735_011974 | 3300042624 | Bacteria | 1810 |
| 71 | Ga0466703_256098 | 3300042636 | Unclassified | 11370 |
| 72 | Ga0123357_10070416 | 3300009784 | Bacteria | 4645 |
| 73 | Ga0466722_264069 | 3300042609 | Bacteria | 2824 |
| 74 | Ga0562379_0044 | 3300056790 | Bacteria | 597058 |
| 75 | Ga0562379_0792 | 3300056790 | Bacteria | 50943 |
| 76 | Ga0562376_0988 | 3300056857 | Unclassified | 43547 |
| 77 | Ga0068305_10065862 | 3300005083 | Bacteria | 5770 |
| 78 | Ga0072940_1019576 | 3300005200 | Bacteria | 1742 |
| 79 | Ga0102734_1000145 | 3300007129 | Bacteria | 23085 |
| 80 | Ga0466729_260309 | 3300042621 | Bacteria | 2428 |
| 81 | Ga0466729_317027 | 3300042621 | Unclassified | 1865 |
| 82 | Ga0466731_048861 | 3300042622 | Bacteria | 1549 |
| 83 | Ga0123355_10776602 | 3300009826 | Bacteria | 1075 |
| 84 | Ga0160467_100118 | 3300012829 | Bacteria | 113293 |
| 85 | Ga0466706_179425 | 3300042599 | Bacteria | 21667 |
| 86 | Ga0466706_242298 | 3300042599 | Bacteria | 1755 |
| 87 | Ga0466706_259031 | 3300042599 | Unclassified | 2238 |
| 88 | Ga0466707_075174 | 3300042601 | Bacteria | 159565 |
| 89 | Ga0466707_149263 | 3300042601 | Bacteria | 3412 |
| 90 | Ga0466713_090642 | 3300042602 | Bacteria | 74862 |
| 91 | Ga0530661_000104 | 3300056564 | Bacteria | 78023 |
| 92 | Ga0562379_0078 | 3300056790 | Bacteria | 360595 |
| 93 | Ga0562379_0988 | 3300056790 | Bacteria | 40082 |
| 94 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 95 | Ga0562375_2309 | 3300056856 | Bacteria | 21727 |
| 96 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 97 | 2211830525 | 2209111004 | Bacteria | 29340 |
| 98 | 2227247454 | 2225789004 | Bacteria | 31994 |
| 99 | IMNBL1DRAFT_c0000020 | 3300000062 | Bacteria | 157199 |
| 100 | IMNBL1DRAFT_c0027052 | 3300000062 | Bacteria | 2166 |
| 101 | IMNBL1DRAFT_c0034775 | 3300000062 | Unclassified | 1787 |
| 102 | Ga0074278_131433 | 3300005721 | Unclassified | 1119 |
| 103 | Ga0466715_006667 | 3300042616 | Bacteria | 9568 |
| 104 | Ga0466728_392215 | 3300042620 | Bacteria | 16026 |
| 105 | Ga0123355_11231048 | 3300009826 | Bacteria | 760 |
| 106 | Ga0123353_10878884 | 3300010167 | Bacteria | 1224 |
| 107 | Ga0160452_100277 | 3300012834 | Bacteria | 48531 |
| 108 | Ga0466691_031800 | 3300042593 | Bacteria | 8623 |
| 109 | Ga0466706_154742 | 3300042599 | Bacteria | 4199 |
| 110 | Ga0466700_380303 | 3300042600 | Bacteria | 16625 |
| 111 | Ga0466707_348719 | 3300042601 | Bacteria | 1676 |
| 112 | Ga0530661_133097 | 3300056564 | Unclassified | 677 |
| 113 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 114 | Ga0562379_0397 | 3300056790 | Bacteria | 98115 |
| 115 | Ga0562379_4066 | 3300056790 | Bacteria | 8211 |
| 116 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 117 | Ga0562374_0034 | 3300057007 | Bacteria | 713140 |
| 118 | 2227035924 | 2225789003 | Bacteria | 19272 |
| 119 | IMNBL1DRAFT_c0000038 | 3300000062 | Bacteria | 119602 |
| 120 | IMNBL1DRAFT_c0000064 | 3300000062 | Bacteria | 97351 |
| 121 | JGI24703J35330_11082659 | 3300002501 | Bacteria | 680 |
| 122 | Ga0063521_1000516 | 3300003973 | Unclassified | 17436 |
| 123 | Ga0466734_105387 | 3300042623 | Bacteria | 1166 |
| 124 | Ga0466730_024004 | 3300042625 | Unclassified | 2416 |
| 125 | Ga0466702_254670 | 3300042635 | Bacteria | 3052 |
| 126 | Ga0466709_233970 | 3300042648 | Bacteria | 334556 |
| 127 | Ga0160464_100506 | 3300012805 | Bacteria | 27578 |
| 128 | Ga0466706_072386 | 3300042599 | Unclassified | 9353 |
| 129 | Ga0466707_131389 | 3300042601 | Bacteria | 97048 |
| 130 | Ga0466716_490221 | 3300042605 | Bacteria | 3523 |
| 131 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 132 | 2227330771 | 2225789004 | Bacteria | 28942 |
| 133 | IMNBL1DRAFT_c0061707 | 3300000062 | Bacteria | 1123 |
| 134 | HBC_ctgsDRAFT_1048893 | 3300000333 | Bacteria | 1029 |
| 135 | JGI24703J35330_11563134 | 3300002501 | Bacteria | 1259 |
| 136 | CVPL010L_1000711 | 3300002932 | Unclassified | 8923 |
| 137 | Ga0466735_062691 | 3300042624 | Bacteria | 1066 |
| 138 | Ga0466702_084551 | 3300042635 | Bacteria | 147089 |
| 139 | Ga0123355_10242239 | 3300009826 | Bacteria | 2553 |
| 140 | Ga0123354_10560571 | 3300010882 | Bacteria | 856 |
| 141 | Ga0160466_101373 | 3300012809 | Bacteria | 6718 |
| 142 | Ga0160443_102554 | 3300012848 | Unclassified | 3899 |
| 143 | Ga0466691_205177 | 3300042593 | Bacteria | 14637 |
| 144 | Ga0466701_007980 | 3300042598 | Bacteria | 74772 |
| 145 | Ga0466706_090237 | 3300042599 | Bacteria | 1057 |
| 146 | Ga0466700_171056 | 3300042600 | Bacteria | 1701 |
| 147 | Ga0466713_053428 | 3300042602 | Bacteria | 4860 |
| 148 | Ga0466719_369831 | 3300042606 | Bacteria | 20033 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 60 | 194 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.