Protein Family IF00254

Metagenome Isolate
387 Members
298 Samples
148 Scaffolds
172.55 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0045679|IMNBL1DRAFT_00456792
Length
208 aa
Sequence
VRYLNEIYAFCCLKNTRKNDILLELSQIEGVEVMKKIEEYVRSIKDFPEEGIIFRDITSILEDADGLKLAVDLMQEKVENEEFDIVIGPESRGFIFGMPIAYNMHKAFVPIRKKGKLPCETVGIKYELEYGTAELELHRSAIKKGDKVVIIDDLMATGGTTEAMIQLIEGLGGIVVKIVFLIELKGLEGIKRLDGYQVESIISYEGK*

πŸ“Š Sample Types

Isolate 61.8%
Metagenome 38.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 23.8%
Apidae 15.9%
Blattidae 10.8%
Drosophilidae 9.0%
Termitidae 7.9%
Scarabaeidae 3.6%
Halictidae 3.2%
Tenebrionidae 2.9%
Elmidae 2.5%
Kalotermitidae 2.5%
Pyralidae 2.2%
Formicidae 2.2%
Armadillidiidae 1.1%
Bombycidae 1.1%
Rhinotermitidae 1.1%
Dytiscidae 1.1%
Termopsidae 1.1%
Passalidae 1.1%
Noctuidae 0.7%
Culicidae 0.7%
Calliphoridae 0.4%
Vespidae 0.4%
Sarcophagidae 0.4%
Hodotermitidae 0.4%
Libellulidae 0.4%
Eresidae 0.4%
Euphausiidae 0.4%
Stratiomyidae 0.4%
Ocypodidae 0.4%
Gomphidae 0.4%
Nephropidae 0.4%
Portunidae 0.4%
Penaeidae 0.4%
Hydrophilidae 0.4%
Curculionidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 363
Eukaryota 0
Viruses 0
Unclassified 24

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
3 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
4 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
5 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
6 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
7 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
8 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
9 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
10 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
11 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
12 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
13 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
14 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
15 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
16 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
17 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
18 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
19 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
20 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
21 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
22 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
23 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
24 2590828839 Clostridium sp. 1 Isolate Termitidae
25 2595698193 Melissococcus plutonius B5 Isolate Apidae
26 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
27 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
28 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
29 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
30 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
31 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
32 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
33 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
34 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
35 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
36 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
37 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
42 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
43 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
44 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
45 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
46 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
47 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
48 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
49 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
50 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
54 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
55 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
56 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
57 2864895409 Bacillus aerius S00152 Isolate Elmidae
58 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
59 2916858470 Heyndrickxia oleronia Isolate Unclassified
60 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
61 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
62 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
63 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
64 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
65 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
66 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
67 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
68 2595698197 Melissococcus plutonius H6 Isolate Apidae
69 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
70 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
71 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
72 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
73 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
74 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
75 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
76 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
77 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
78 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
79 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
80 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
81 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
82 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
83 8022725327 Bacillus sp. SN10 Isolate Eresidae
84 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
85 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
86 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
87 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
88 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
89 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
90 8112490586 Staphylococcus muscae CCM 4175 Isolate
91 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
92 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
93 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
94 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
95 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
96 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
97 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
98 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
99 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
100 2537562000 Bacillus cereus HD73 Isolate Pyralidae
101 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
102 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
103 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
104 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
105 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
106 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
107 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
108 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
109 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
110 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
111 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
112 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
113 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
114 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
115 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
116 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
117 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
118 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
119 8108568626 Enterococcus sp. DIV1094 Isolate
120 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
121 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
122 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
123 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
124 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
125 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
126 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
127 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
128 2864909992 Bacillus velezensis S00166 Isolate Elmidae
129 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
130 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
131 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
132 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
133 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
134 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
135 2595698199 Melissococcus plutonius 60 Isolate Apidae
136 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
137 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
138 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
139 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
140 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
141 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
142 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
143 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
144 3004719924 Lactobacillus sp. W8174 Isolate Apidae
145 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
146 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
147 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
148 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
149 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
150 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
151 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
152 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
153 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
154 8007237282 Enterococcus sp. DIV0212c Isolate
155 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
156 8017489919 Lactobacillus brevis EF Isolate Unclassified
157 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
158 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
159 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
160 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
161 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
162 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
163 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
164 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
165 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
166 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
167 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
168 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
169 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
170 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
171 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
172 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
173 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
174 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
175 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
176 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
177 2595698195 Melissococcus plutonius 119 Isolate Apidae
178 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
179 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
180 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
181 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
182 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
183 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
184 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
185 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
186 2978778678 Bacillus cereus 25 Isolate Ocypodidae
187 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
188 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
189 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
190 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
191 8007223943 Enterococcus sp. MSG2901 Isolate
192 8012112996 Staphylococcus muscae ATCC 49910 Isolate
193 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
194 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
195 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
196 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
197 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
198 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
199 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
200 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
201 8114555646 Enterococcus sp. DIV1094 Isolate
202 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
203 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
204 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
205 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
206 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
207 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
208 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
209 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
210 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
211 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
212 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
213 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
214 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
215 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
216 2627853628 Melissococcus plutonius 82 Isolate Apidae
217 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
218 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
219 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
220 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
221 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
222 2969145278 Bacillus cereus 29 Isolate Portunidae
223 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
224 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
225 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
226 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
227 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
228 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
229 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
230 8064008355 Heyndrickxia oleronia Isolate Unclassified
231 8082023105 Niallia sp. Man26 Isolate Penaeidae
232 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
233 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
234 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
235 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
236 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
237 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
238 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
239 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
240 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
241 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
242 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
243 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
244 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
245 2595698198 Melissococcus plutonius L9 Isolate Apidae
246 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
247 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
248 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
249 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
250 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
251 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
252 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
253 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
254 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
255 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
256 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
257 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
258 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
259 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
260 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
261 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
262 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
263 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
264 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
265 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
266 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
267 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
268 2864801025 Bacillus aerius S00042 Isolate Elmidae
269 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
270 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
271 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
272 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
273 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
274 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
275 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
276 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
277 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
278 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
279 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
280 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
281 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
282 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
283 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
284 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
285 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
286 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
287 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
288 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
289 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
290 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
291 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
292 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
293 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
294 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
295 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
296 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
297 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
298 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0234 3300056814 Unclassified 130023
2 Ga0562374_0082 3300057007 Unclassified 284758
3 Ga0562374_1124 3300057007 Bacteria 34534
4 IMNBL1DRAFT_c0026799 3300000062 Bacteria 2182
5 AustNasuHG_c1008064 3300000089 Bacteria 3733
6 HBC_ctgsDRAFT_1046711 3300000333 Unclassified 1055
7 JGI24703J35330_11747613 3300002501 Bacteria 7443
8 JGI24703J35330_11747864 3300002501 Bacteria 8708
9 Ga0466715_357572 3300042616 Bacteria 181743
10 Ga0466715_589362 3300042616 Bacteria 11751
11 Ga0466726_099829 3300042619 Bacteria 117568
12 Ga0466727_057228 3300042655 Bacteria 28562
13 Ga0123357_10124412 3300009784 Bacteria 3235
14 Ga0123355_10515977 3300009826 Bacteria 1465
15 Ga0123356_11408360 3300010049 Bacteria 857
16 Ga0123353_10061193 3300010167 Bacteria 6037
17 Ga0255576_1000001 3300026558 Bacteria 687723
18 Ga0255575_1000007 3300026559 Bacteria 308135
19 Ga0466706_245779 3300042599 Bacteria 3103
20 Ga0466707_274249 3300042601 Bacteria 61467
21 Ga0466707_353762 3300042601 Bacteria 3560
22 Ga0562379_0009 3300056790 Bacteria 1927879
23 Ga0562379_0275 3300056790 Bacteria 132969
24 Ga0562379_0393 3300056790 Bacteria 98832
25 Ga0562378_0096 3300056814 Bacteria 246586
26 Ga0562378_1859 3300056814 Bacteria 20521
27 Ga0562375_3099 3300056856 Unclassified 16553
28 2227512969 2225789004 Unclassified 3512
29 HBC_ctgsDRAFT_1005941 3300000333 Unclassified 2868
30 JGI24700J35501_10930144 3300002508 Bacteria 11696
31 Ga0466715_199540 3300042616 Bacteria 144220
32 Ga0466715_428250 3300042616 Bacteria 21415
33 Ga0466709_147924 3300042648 Bacteria 39050
34 Ga0123355_10207381 3300009826 Bacteria 2848
35 Ga0123353_10026587 3300010167 Bacteria 8845
36 Ga0123353_10700972 3300010167 Bacteria 1421
37 Ga0160445_102567 3300012847 Bacteria 4112
38 Ga0466700_301077 3300042600 Bacteria 28487
39 Ga0466707_412451 3300042601 Bacteria 3315
40 Ga0466713_052392 3300042602 Bacteria 216200
41 Ga0466714_118011 3300042603 Bacteria 1074
42 Ga0466722_067396 3300042609 Bacteria 1364
43 Ga0466732_349506 3300042656 Bacteria 1826
44 Ga0466733_070008 3300042659 Bacteria 50555
45 IMNBL1DRAFT_c0058248 3300000062 Bacteria 1174
46 Ga0072940_1290108 3300005200 Bacteria 914
47 Ga0074278_102193 3300005721 Bacteria 17666
48 Ga0074278_105617 3300005721 Unclassified 1640
49 Ga0466709_044661 3300042648 Bacteria 1759
50 Ga0123353_10019469 3300010167 Unclassified 10087
51 Ga0160471_107834 3300012812 Bacteria 1273
52 Ga0466706_009084 3300042599 Bacteria 5566
53 Ga0466706_182763 3300042599 Bacteria 15291
54 Ga0466713_072041 3300042602 Bacteria 94552
55 Ga0466733_073226 3300042659 Bacteria 1841
56 Ga0530661_001808 3300056564 Unclassified 9598
57 Ga0562379_0011 3300056790 Bacteria 1623141
58 Ga0562375_0742 3300056856 Unclassified 57376
59 Ga0562376_0005 3300056857 Bacteria 2173693
60 Ga0562376_0481 3300056857 Bacteria 72588
61 Ga0562374_3603 3300057007 Unclassified 7787
62 2227364454 2225789004 Bacteria 1122
63 2227384418 2225789004 Bacteria 1095
64 IMNBL1DRAFT_c0000007 3300000062 Bacteria 246638
65 IMNBL1DRAFT_c0045679 3300000062 Bacteria 1428
66 HBC_ctgsDRAFT_1000122 3300000333 Bacteria 18957
67 HBC_ctgsDRAFT_1007123 3300000333 Unclassified 2630
68 Ga0466710_228698 3300042613 Bacteria 1714
69 Ga0466715_041286 3300042616 Bacteria 1963
70 Ga0466735_011974 3300042624 Bacteria 1810
71 Ga0466703_256098 3300042636 Unclassified 11370
72 Ga0123357_10070416 3300009784 Bacteria 4645
73 Ga0466722_264069 3300042609 Bacteria 2824
74 Ga0562379_0044 3300056790 Bacteria 597058
75 Ga0562379_0792 3300056790 Bacteria 50943
76 Ga0562376_0988 3300056857 Unclassified 43547
77 Ga0068305_10065862 3300005083 Bacteria 5770
78 Ga0072940_1019576 3300005200 Bacteria 1742
79 Ga0102734_1000145 3300007129 Bacteria 23085
80 Ga0466729_260309 3300042621 Bacteria 2428
81 Ga0466729_317027 3300042621 Unclassified 1865
82 Ga0466731_048861 3300042622 Bacteria 1549
83 Ga0123355_10776602 3300009826 Bacteria 1075
84 Ga0160467_100118 3300012829 Bacteria 113293
85 Ga0466706_179425 3300042599 Bacteria 21667
86 Ga0466706_242298 3300042599 Bacteria 1755
87 Ga0466706_259031 3300042599 Unclassified 2238
88 Ga0466707_075174 3300042601 Bacteria 159565
89 Ga0466707_149263 3300042601 Bacteria 3412
90 Ga0466713_090642 3300042602 Bacteria 74862
91 Ga0530661_000104 3300056564 Bacteria 78023
92 Ga0562379_0078 3300056790 Bacteria 360595
93 Ga0562379_0988 3300056790 Bacteria 40082
94 Ga0562375_0013 3300056856 Bacteria 1229523
95 Ga0562375_2309 3300056856 Bacteria 21727
96 Ga0562374_0008 3300057007 Bacteria 1999653
97 2211830525 2209111004 Bacteria 29340
98 2227247454 2225789004 Bacteria 31994
99 IMNBL1DRAFT_c0000020 3300000062 Bacteria 157199
100 IMNBL1DRAFT_c0027052 3300000062 Bacteria 2166
101 IMNBL1DRAFT_c0034775 3300000062 Unclassified 1787
102 Ga0074278_131433 3300005721 Unclassified 1119
103 Ga0466715_006667 3300042616 Bacteria 9568
104 Ga0466728_392215 3300042620 Bacteria 16026
105 Ga0123355_11231048 3300009826 Bacteria 760
106 Ga0123353_10878884 3300010167 Bacteria 1224
107 Ga0160452_100277 3300012834 Bacteria 48531
108 Ga0466691_031800 3300042593 Bacteria 8623
109 Ga0466706_154742 3300042599 Bacteria 4199
110 Ga0466700_380303 3300042600 Bacteria 16625
111 Ga0466707_348719 3300042601 Bacteria 1676
112 Ga0530661_133097 3300056564 Unclassified 677
113 Ga0562379_0005 3300056790 Bacteria 2649770
114 Ga0562379_0397 3300056790 Bacteria 98115
115 Ga0562379_4066 3300056790 Bacteria 8211
116 Ga0562375_0096 3300056856 Bacteria 273717
117 Ga0562374_0034 3300057007 Bacteria 713140
118 2227035924 2225789003 Bacteria 19272
119 IMNBL1DRAFT_c0000038 3300000062 Bacteria 119602
120 IMNBL1DRAFT_c0000064 3300000062 Bacteria 97351
121 JGI24703J35330_11082659 3300002501 Bacteria 680
122 Ga0063521_1000516 3300003973 Unclassified 17436
123 Ga0466734_105387 3300042623 Bacteria 1166
124 Ga0466730_024004 3300042625 Unclassified 2416
125 Ga0466702_254670 3300042635 Bacteria 3052
126 Ga0466709_233970 3300042648 Bacteria 334556
127 Ga0160464_100506 3300012805 Bacteria 27578
128 Ga0466706_072386 3300042599 Unclassified 9353
129 Ga0466707_131389 3300042601 Bacteria 97048
130 Ga0466716_490221 3300042605 Bacteria 3523
131 Ga0530661_000001 3300056564 Bacteria 684835
132 2227330771 2225789004 Bacteria 28942
133 IMNBL1DRAFT_c0061707 3300000062 Bacteria 1123
134 HBC_ctgsDRAFT_1048893 3300000333 Bacteria 1029
135 JGI24703J35330_11563134 3300002501 Bacteria 1259
136 CVPL010L_1000711 3300002932 Unclassified 8923
137 Ga0466735_062691 3300042624 Bacteria 1066
138 Ga0466702_084551 3300042635 Bacteria 147089
139 Ga0123355_10242239 3300009826 Bacteria 2553
140 Ga0123354_10560571 3300010882 Bacteria 856
141 Ga0160466_101373 3300012809 Bacteria 6718
142 Ga0160443_102554 3300012848 Unclassified 3899
143 Ga0466691_205177 3300042593 Bacteria 14637
144 Ga0466701_007980 3300042598 Bacteria 74772
145 Ga0466706_090237 3300042599 Bacteria 1057
146 Ga0466700_171056 3300042600 Bacteria 1701
147 Ga0466713_053428 3300042602 Bacteria 4860
148 Ga0466719_369831 3300042606 Bacteria 20033

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00156 Pribosyltran Phosphoribosyl transferase domain 60 194 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.