Protein Family IF00243
Metagenome
Isolate
253
Members
177
Samples
146
Scaffolds
382.96
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0009316|IMNBL1DRAFT_00093164
- Length
- 451 aa
- Sequence
- MKIAVGLSGGVDSSVAALLLKEAGHDVIALFMQNWHDTTGTLYGDCPWEEDRAVAELVAKKLGIPFYFVDLSATYSQRVVDYMFEEYSRGRTPNPDVMCNREIKFEAFMKHALELGAEMVATGHYCRKEVVVGTDGREIYRILAGVDPGKDQSYFLCQLNQEQLSKALFPIGGLVKSEVRELAAKGGLPTANKKDSQGICFVGKVDLPVFLQQKLAVREGDVVEVFEEFYENHPMVHYVVTGYPEQSLGIKGETGRKSEMESELDAKVSRDSLGTDSCDNTNSYYGMDDGGYEKGDINDFLKNSSQPYKYSCESGRIVGKHRGAHFYTIGQRKGLNIGGHIEPLFIISLDIENNIIYVGEGEMHPGLYRKSLFINCADIHWIRRDLKMEQRETRDYLVRIRYRQPLQKARLFMRDEGLYIVFEEPQRGITPGQFAAWYDGEEMLGSGDIQ*
Sample Types
Isolate
42.3%
Metagenome
57.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.5%
Elmidae
11.8%
Termitidae
11.2%
Kalotermitidae
7.1%
Formicidae
5.9%
Drosophilidae
5.3%
Culicidae
4.7%
Blattidae
3.6%
Apidae
3.0%
Cicadellidae
3.0%
Tenebrionidae
3.0%
Scarabaeidae
2.4%
Curculionidae
2.4%
Termopsidae
1.8%
Pediculidae
1.2%
Passalidae
1.2%
Ixodidae
1.2%
Armadillidiidae
1.2%
Rhinotermitidae
1.2%
Cambaridae
1.2%
Nephropidae
0.6%
Penaeidae
0.6%
Corydiidae
0.6%
Cixiidae
0.6%
Lamproblattidae
0.6%
Euphausiidae
0.6%
Stratiomyidae
0.6%
Hodotermitidae
0.6%
Daphniidae
0.6%
Trigoniulidae
0.6%
Porcellionidae
0.6%
Noctuidae
0.6%
Cryptocercidae
0.6%
Blaberidae
0.6%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 2 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 3 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 4 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 5 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 8 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 9 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 10 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 11 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 12 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 16 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 17 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 23 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 24 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 25 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 26 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 27 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 28 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 29 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 30 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 31 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 32 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 33 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 34 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 35 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 36 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 37 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 38 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 39 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 40 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 41 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 43 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 44 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 45 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 46 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 47 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 48 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 49 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 50 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 51 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 52 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 53 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 54 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 55 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 56 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 59 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 60 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 61 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 62 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 63 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 64 | 2820572885 | Unclassified Firmicutes Emb289P3bin161 | Isolate | Unclassified |
| 65 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 66 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 67 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 70 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 71 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 72 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 73 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 74 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 75 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 82 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 83 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 84 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 85 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 86 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 87 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 88 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 89 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 90 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 91 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 92 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 93 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 94 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 95 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 96 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 97 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 98 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 99 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 100 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 101 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 102 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 103 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 104 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 105 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 106 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 107 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 108 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 109 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 110 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 111 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 112 | 2772190788 | Candidatus Riesia pediculischaeffi PTSK | Isolate | Pediculidae |
| 113 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 114 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 115 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 116 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 117 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 118 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 119 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 120 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 121 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 122 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 123 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 124 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 125 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 126 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 127 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 128 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 129 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 130 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 131 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 132 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 133 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 134 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 135 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 136 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 137 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 138 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 139 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 140 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 141 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 142 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 143 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 144 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 145 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 146 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 147 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 148 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 149 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 150 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 151 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 152 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 153 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 154 | 8073539042 | Candidatus Rhabdochlamydia porcellionis 15C | Isolate | Porcellionidae |
| 155 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 156 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 157 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 158 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 159 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 160 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 161 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 162 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 163 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 164 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 165 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 166 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 167 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 168 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 169 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 170 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 171 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 172 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 173 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 174 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 175 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 176 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
| 177 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10037959 | 3300009826 | Bacteria | 7832 |
| 2 | Ga0123353_10210046 | 3300010167 | Bacteria | 3054 |
| 3 | Ga0160448_104294 | 3300012854 | Bacteria | 3997 |
| 4 | Ga0466706_006897 | 3300042599 | Bacteria | 5090 |
| 5 | Ga0466722_125534 | 3300042609 | Bacteria | 5171 |
| 6 | IMNBL1DRAFT_c0003675 | 3300000062 | Bacteria | 9672 |
| 7 | Ga0466729_089825 | 3300042621 | Bacteria | 1513 |
| 8 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 9 | Ga0466702_218350 | 3300042635 | Bacteria | 3485 |
| 10 | Ga0466724_29096 | 3300042649 | Bacteria | 63089 |
| 11 | Ga0466708_123364 | 3300042652 | Bacteria | 4700 |
| 12 | Ga0466708_352244 | 3300042652 | Bacteria | 8894 |
| 13 | Ga0466725_093976 | 3300042654 | Bacteria | 35479 |
| 14 | Ga0123355_10476985 | 3300009826 | Bacteria | 1554 |
| 15 | Ga0160453_100268 | 3300012814 | Bacteria | 49445 |
| 16 | Ga0466707_284106 | 3300042601 | Bacteria | 54420 |
| 17 | Ga0466719_047288 | 3300042606 | Bacteria | 7845 |
| 18 | 2227495762 | 2225789004 | Bacteria | 3937 |
| 19 | IMNBL1DRAFT_c0012115 | 3300000062 | Bacteria | 3968 |
| 20 | Meta3P_1001089 | 3300002464 | Unclassified | 25674 |
| 21 | JGI24700J35501_10930934 | 3300002508 | Bacteria | 66586 |
| 22 | Ga0103265_1000006 | 3300007068 | Bacteria | 82165 |
| 23 | Ga0103267_1000987 | 3300007190 | Bacteria | 7132 |
| 24 | Ga0466705_447695 | 3300042612 | Bacteria | 15480 |
| 25 | Ga0466723_270766 | 3300042618 | Bacteria | 18832 |
| 26 | Ga0466728_324049 | 3300042620 | Bacteria | 45950 |
| 27 | Ga0466729_147055 | 3300042621 | Bacteria | 2201 |
| 28 | Ga0466735_236365 | 3300042624 | Bacteria | 34484 |
| 29 | Ga0466730_011896 | 3300042625 | Unclassified | 1094 |
| 30 | Ga0466730_067124 | 3300042625 | Bacteria | 117554 |
| 31 | Ga0466724_03451 | 3300042649 | Bacteria | 343609 |
| 32 | Ga0123353_10000026 | 3300010167 | Bacteria | 168247 |
| 33 | Ga0123353_10002615 | 3300010167 | Bacteria | 22403 |
| 34 | Ga0160455_100769 | 3300012837 | Bacteria | 12835 |
| 35 | Ga0466690_326615 | 3300042590 | Bacteria | 4228 |
| 36 | Ga0466690_379973 | 3300042590 | Bacteria | 15164 |
| 37 | Ga0466696_455470 | 3300042596 | Bacteria | 5396 |
| 38 | Ga0466701_020904 | 3300042598 | Bacteria | 560833 |
| 39 | Ga0466719_490225 | 3300042606 | Bacteria | 3999 |
| 40 | Ga0466722_056908 | 3300042609 | Bacteria | 8006 |
| 41 | HBC_ctgsDRAFT_1000014 | 3300000333 | Bacteria | 48411 |
| 42 | JGI24705J35276_12236503 | 3300002504 | Bacteria | 8210 |
| 43 | CVPL010W_10000918 | 3300002931 | Bacteria | 33396 |
| 44 | Ga0072941_1027732 | 3300005201 | Bacteria | 10583 |
| 45 | Ga0072941_1267833 | 3300005201 | Bacteria | 5542 |
| 46 | Ga0104045_1019510 | 3300007085 | Unclassified | 3702 |
| 47 | Ga0102737_1000066 | 3300007142 | Bacteria | 32096 |
| 48 | Ga0104019_1002126 | 3300007150 | Bacteria | 20924 |
| 49 | Ga0466730_050917 | 3300042625 | Unclassified | 15813 |
| 50 | Ga0466708_018399 | 3300042652 | Bacteria | 49081 |
| 51 | Ga0466708_138438 | 3300042652 | Bacteria | 9602 |
| 52 | Ga0466708_206183 | 3300042652 | Bacteria | 28300 |
| 53 | Ga0466705_046890 | 3300042612 | Bacteria | 10925 |
| 54 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 55 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 56 | Ga0123354_10013623 | 3300010882 | Bacteria | 12627 |
| 57 | Ga0466691_031566 | 3300042593 | Bacteria | 18938 |
| 58 | Ga0466707_369273 | 3300042601 | Bacteria | 5554 |
| 59 | 2227358546 | 2225789004 | Bacteria | 129386 |
| 60 | IMNBL1DRAFT_c0000291 | 3300000062 | Unclassified | 43209 |
| 61 | CVPL010L_1000435 | 3300002932 | Unclassified | 16090 |
| 62 | Ga0072941_1140860 | 3300005201 | Bacteria | 2418 |
| 63 | Ga0072941_1467671 | 3300005201 | Bacteria | 1608 |
| 64 | Ga0103265_1002177 | 3300007068 | Bacteria | 4257 |
| 65 | Ga0102734_1000018 | 3300007129 | Bacteria | 153503 |
| 66 | Ga0104019_1003614 | 3300007150 | Unclassified | 3631 |
| 67 | Ga0104050_1001439 | 3300007153 | Bacteria | 6525 |
| 68 | Ga0466711_503166 | 3300042615 | Bacteria | 8946 |
| 69 | Ga0466723_101296 | 3300042618 | Bacteria | 56220 |
| 70 | Ga0466726_063319 | 3300042619 | Bacteria | 3800 |
| 71 | Ga0466726_190142 | 3300042619 | Bacteria | 1447 |
| 72 | Ga0466726_449131 | 3300042619 | Bacteria | 1430 |
| 73 | Ga0466735_092551 | 3300042624 | Bacteria | 5246 |
| 74 | Ga0466703_165189 | 3300042636 | Bacteria | 7217 |
| 75 | Ga0466724_16100 | 3300042649 | Unclassified | 5335 |
| 76 | Ga0466732_318428 | 3300042656 | Bacteria | 4996 |
| 77 | Ga0466733_210667 | 3300042659 | Bacteria | 15888 |
| 78 | Ga0562379_0039 | 3300056790 | Bacteria | 641946 |
| 79 | Ga0562376_0005 | 3300056857 | Bacteria | 2173693 |
| 80 | Ga0123355_10138448 | 3300009826 | Bacteria | 3733 |
| 81 | Ga0123356_10007396 | 3300010049 | Unclassified | 10956 |
| 82 | Ga0466657_249385 | 3300042582 | Bacteria | 4755 |
| 83 | Ga0466691_025331 | 3300042593 | Bacteria | 5017 |
| 84 | Ga0466707_113879 | 3300042601 | Bacteria | 6982 |
| 85 | Ga0466714_011286 | 3300042603 | Bacteria | 5135 |
| 86 | IMNBL1DRAFT_c0006234 | 3300000062 | Bacteria | 6554 |
| 87 | JGI24703J35330_11747874 | 3300002501 | Bacteria | 8764 |
| 88 | Ga0063521_1003746 | 3300003973 | Bacteria | 3599 |
| 89 | Ga0102736_1000185 | 3300007052 | Bacteria | 16115 |
| 90 | Ga0103267_1000136 | 3300007190 | Bacteria | 33714 |
| 91 | Ga0105005_1132576 | 3300007505 | Bacteria | 2086 |
| 92 | Ga0466711_066483 | 3300042615 | Bacteria | 17172 |
| 93 | Ga0466711_113058 | 3300042615 | Bacteria | 9358 |
| 94 | Ga0466726_189556 | 3300042619 | Bacteria | 12193 |
| 95 | Ga0466704_503952 | 3300042643 | Unclassified | 15385 |
| 96 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 97 | Ga0466727_024060 | 3300042655 | Unclassified | 6096 |
| 98 | Ga0466733_026832 | 3300042659 | Bacteria | 4125 |
| 99 | Ga0562375_3147 | 3300056856 | Bacteria | 16352 |
| 100 | Ga0123355_10016456 | 3300009826 | Bacteria | 11654 |
| 101 | Ga0123355_10173205 | 3300009826 | Bacteria | 3220 |
| 102 | Ga0123356_10021606 | 3300010049 | Bacteria | 6074 |
| 103 | Ga0160464_100171 | 3300012805 | Bacteria | 69359 |
| 104 | Ga0466696_368802 | 3300042596 | Bacteria | 221772 |
| 105 | Ga0466701_028458 | 3300042598 | Bacteria | 116962 |
| 106 | Ga0466706_089736 | 3300042599 | Unclassified | 2605 |
| 107 | 2227463537 | 2225789004 | Bacteria | 25071 |
| 108 | JGI24703J35330_11748764 | 3300002501 | Bacteria | 32461 |
| 109 | JGI24700J35501_10787860 | 3300002508 | Bacteria | 1491 |
| 110 | Ga0074308_1115205 | 3300005307 | Bacteria | 1446 |
| 111 | Ga0103261_1000035 | 3300007083 | Bacteria | 82381 |
| 112 | Ga0104048_1004371 | 3300007143 | Unclassified | 8103 |
| 113 | Ga0104019_1003763 | 3300007150 | Unclassified | 4533 |
| 114 | Ga0104050_1029253 | 3300007153 | Unclassified | 4187 |
| 115 | Ga0127649_100183 | 3300009460 | Bacteria | 42483 |
| 116 | Ga0466715_042327 | 3300042616 | Bacteria | 18793 |
| 117 | Ga0466715_389792 | 3300042616 | Bacteria | 16335 |
| 118 | Ga0466723_365544 | 3300042618 | Bacteria | 7696 |
| 119 | Ga0466726_191400 | 3300042619 | Bacteria | 1838 |
| 120 | Ga0466724_46924 | 3300042649 | Bacteria | 25048 |
| 121 | Ga0466727_326225 | 3300042655 | Bacteria | 66208 |
| 122 | Ga0123355_10037884 | 3300009826 | Bacteria | 7843 |
| 123 | Ga0160435_1008284 | 3300012857 | Bacteria | 2244 |
| 124 | Ga0466701_015877 | 3300042598 | Bacteria | 22927 |
| 125 | Ga0466713_050327 | 3300042602 | Unclassified | 100687 |
| 126 | Ga0466714_102951 | 3300042603 | Bacteria | 4865 |
| 127 | Ga0466721_083984 | 3300042608 | Bacteria | 20111 |
| 128 | IMNBL1DRAFT_c0009316 | 3300000062 | Bacteria | 4860 |
| 129 | JGI24702J35022_10008149 | 3300002462 | Bacteria | 5954 |
| 130 | JGI24703J35330_11748832 | 3300002501 | Bacteria | 43139 |
| 131 | Ga0103264_1000008 | 3300007188 | Bacteria | 140843 |
| 132 | Ga0466723_092600 | 3300042618 | Bacteria | 7918 |
| 133 | Ga0466729_005455 | 3300042621 | Bacteria | 9283 |
| 134 | Ga0466704_350613 | 3300042643 | Bacteria | 10232 |
| 135 | Ga0466705_052637 | 3300042612 | Bacteria | 5678 |
| 136 | Ga0466733_023265 | 3300042659 | Bacteria | 18184 |
| 137 | Ga0123355_10044345 | 3300009826 | Bacteria | 7239 |
| 138 | Ga0466690_104073 | 3300042590 | Bacteria | 10792 |
| 139 | Ga0466701_062333 | 3300042598 | Bacteria | 75358 |
| 140 | 2227635737 | 2225789004 | Bacteria | 11180 |
| 141 | Ga0466710_186254 | 3300042613 | Bacteria | 1772 |
| 142 | Ga0466728_023238 | 3300042620 | Bacteria | 7234 |
| 143 | Ga0466728_248724 | 3300042620 | Bacteria | 10593 |
| 144 | Ga0466735_104941 | 3300042624 | Bacteria | 3660 |
| 145 | Ga0466730_058632 | 3300042625 | Bacteria | 2114 |
| 146 | Ga0466703_191566 | 3300042636 | Bacteria | 3030 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03054 | tRNA_Me_trans | tRNA methyl transferase HUP domain | 1 | 204 | 0.98 |
| PF20258 | tRNA_Me_trans_C | Aminomethyltransferase beta-barrel domain | 376 | 449 | 0.94 |
| PF20259 | tRNA_Me_trans_M | tRNA methyl transferase PRC-barrel domain | 310 | 360 | 0.91 |
| PF02540 | NAD_synthase | NAD synthase | 2 | 125 | 0.66 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.