Protein Family IF00211
Metagenome
Isolate
285
Members
148
Samples
198
Scaffolds
219.02
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0001057|IMNBL1DRAFT_000105717
- Length
- 261 aa
- Sequence
- MIDENFGKKDQRGVYYSLFTPLCFATCPLFTTFTSIIDSMQLNMSHKIAPSLLSANFLNLEADIEMINNSEADWFHXDVMDGTFVPNISFGFPIIKQISKIAKKPLDVHLMIENPDKYISVVRDSGAYMMNVHYEACTHLHRVIGAIHDAGMKAAVTLNPHTPISLLEDILQDLDMVLLMTVNPGFGGQKFIEHSISKVTRLKEMIRERNLHTLIEVDGGVNLETGKRLVAAGADVLVAGNAVFADANPTEMIHKLKSIT*
Sample Types
Isolate
30.5%
Metagenome
69.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.9%
Blattidae
19.9%
Termitidae
19.2%
Apidae
13.0%
Kalotermitidae
8.9%
Rhinotermitidae
4.1%
Termopsidae
2.7%
Scarabaeidae
2.1%
Hydrophilidae
1.4%
Passalidae
1.4%
Formicidae
1.4%
Tenebrionidae
1.4%
Culicidae
1.4%
Drosophilidae
0.7%
Elmidae
0.7%
Euphausiidae
0.7%
Hodotermitidae
0.7%
Armadillidiidae
0.7%
Taxonomy
Archaea
0
Bacteria
282
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 4 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 5 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 6 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 7 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 8 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 9 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 10 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 11 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 12 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 13 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 25 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 26 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 27 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 28 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 29 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 32 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 35 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 36 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 37 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 38 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 39 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 40 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 41 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 42 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 43 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 44 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 45 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 46 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 49 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 50 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 56 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 57 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 58 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 59 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 60 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 61 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 65 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 66 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 67 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 68 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 69 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 73 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 74 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 75 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 76 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 77 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 78 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 79 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 80 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 81 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 82 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 83 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 84 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 85 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 86 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 87 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 88 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 89 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 90 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 91 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 92 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 93 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 94 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 95 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 96 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 97 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 98 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 99 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 100 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 101 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 102 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 103 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 104 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 105 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 106 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 107 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 108 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 109 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 110 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 111 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 112 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 113 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 114 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 115 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 116 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 117 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 118 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 119 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 120 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 121 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 122 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 123 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 124 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 125 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 126 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 127 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 128 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 129 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 130 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 131 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 132 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 133 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 134 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 135 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 136 | 2820439761 | Unclassified Firmicutes Lab288P3bin203 | Isolate | Unclassified |
| 137 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 138 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 139 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 140 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 141 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 142 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 143 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 144 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 145 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 146 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 147 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 148 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_048851 | 3300042659 | Bacteria | 143671 |
| 2 | Ga0530661_000004 | 3300056564 | Bacteria | 460556 |
| 3 | Ga0068305_10102235 | 3300005083 | Bacteria | 10518 |
| 4 | Ga0123357_10000359 | 3300009784 | Bacteria | 42994 |
| 5 | Ga0123357_10000506 | 3300009784 | Bacteria | 37968 |
| 6 | Ga0466731_055605 | 3300042622 | Bacteria | 2701 |
| 7 | Ga0466731_384484 | 3300042622 | Bacteria | 1257 |
| 8 | Ga0466730_084221 | 3300042625 | Unclassified | 3878 |
| 9 | Ga0466704_170345 | 3300042643 | Bacteria | 10623 |
| 10 | Ga0466691_038094 | 3300042593 | Bacteria | 2026 |
| 11 | Ga0466696_028061 | 3300042596 | Bacteria | 36603 |
| 12 | Ga0466711_270449 | 3300042615 | Bacteria | 10982 |
| 13 | Ga0466715_030791 | 3300042616 | Bacteria | 10163 |
| 14 | Ga0466715_422994 | 3300042616 | Bacteria | 4779 |
| 15 | Ga0466728_427153 | 3300042620 | Bacteria | 44524 |
| 16 | Ga0466729_162493 | 3300042621 | Bacteria | 8828 |
| 17 | Ga0123354_10563365 | 3300010882 | Bacteria | 853 |
| 18 | Ga0466707_054984 | 3300042601 | Bacteria | 22397 |
| 19 | Ga0466713_059657 | 3300042602 | Bacteria | 33008 |
| 20 | Ga0466713_124503 | 3300042602 | Bacteria | 30034 |
| 21 | Ga0466716_392900 | 3300042605 | Bacteria | 11003 |
| 22 | Ga0466733_004143 | 3300042659 | Bacteria | 13018 |
| 23 | Ga0466733_027595 | 3300042659 | Bacteria | 96004 |
| 24 | IMNBL1DRAFT_c0001057 | 3300000062 | Bacteria | 21301 |
| 25 | JGI24696J40584_12959499 | 3300002834 | Bacteria | 5215 |
| 26 | Ga0466703_102694 | 3300042636 | Bacteria | 16751 |
| 27 | Ga0466703_137673 | 3300042636 | Bacteria | 7150 |
| 28 | Ga0466704_016620 | 3300042643 | Bacteria | 21682 |
| 29 | Ga0466704_202615 | 3300042643 | Bacteria | 9803 |
| 30 | Ga0466704_267720 | 3300042643 | Bacteria | 30847 |
| 31 | Ga0466725_259771 | 3300042654 | Bacteria | 67209 |
| 32 | Ga0466727_210294 | 3300042655 | Bacteria | 2704 |
| 33 | Ga0466656_280568 | 3300042550 | Bacteria | 1097 |
| 34 | Ga0466690_273455 | 3300042590 | Bacteria | 11832 |
| 35 | Ga0466693_040302 | 3300042592 | Bacteria | 3953 |
| 36 | Ga0466693_148807 | 3300042592 | Bacteria | 1033 |
| 37 | Ga0466711_216209 | 3300042615 | Bacteria | 10718 |
| 38 | Ga0466711_481376 | 3300042615 | Bacteria | 4686 |
| 39 | Ga0466715_416650 | 3300042616 | Bacteria | 71840 |
| 40 | Ga0123353_10188521 | 3300010167 | Bacteria | 3258 |
| 41 | Ga0466713_141674 | 3300042602 | Bacteria | 6891 |
| 42 | Ga0466714_047384 | 3300042603 | Bacteria | 13677 |
| 43 | Ga0466714_084758 | 3300042603 | Bacteria | 2013 |
| 44 | Ga0466719_001774 | 3300042606 | Bacteria | 3280 |
| 45 | Ga0466722_174317 | 3300042609 | Bacteria | 6323 |
| 46 | Ga0466705_080971 | 3300042612 | Bacteria | 12545 |
| 47 | Ga0466735_111227 | 3300042624 | Bacteria | 1154 |
| 48 | Ga0466703_104988 | 3300042636 | Bacteria | 39552 |
| 49 | Ga0466709_380559 | 3300042648 | Bacteria | 3363 |
| 50 | Ga0466727_084228 | 3300042655 | Bacteria | 2404 |
| 51 | Ga0160436_1000564 | 3300012861 | Unclassified | 13487 |
| 52 | Ga0466692_002699 | 3300042591 | Bacteria | 4509 |
| 53 | Ga0466712_041367 | 3300042614 | Bacteria | 2039 |
| 54 | Ga0466715_624866 | 3300042616 | Bacteria | 14808 |
| 55 | Ga0123356_10038012 | 3300010049 | Bacteria | 4488 |
| 56 | Ga0123356_10627156 | 3300010049 | Bacteria | 1241 |
| 57 | Ga0123353_10253053 | 3300010167 | Bacteria | 2726 |
| 58 | Ga0160464_101592 | 3300012805 | Bacteria | 6918 |
| 59 | Ga0160464_105101 | 3300012805 | Bacteria | 1552 |
| 60 | Ga0466706_015316 | 3300042599 | Bacteria | 50470 |
| 61 | Ga0466707_036683 | 3300042601 | Bacteria | 10602 |
| 62 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 63 | Ga0466713_147371 | 3300042602 | Bacteria | 19721 |
| 64 | Ga0466722_043135 | 3300042609 | Bacteria | 7579 |
| 65 | JGI24702J35022_10011877 | 3300002462 | Bacteria | 4850 |
| 66 | JGI24703J35330_11747678 | 3300002501 | Bacteria | 7731 |
| 67 | Ga0068302_10013458 | 3300005071 | Bacteria | 5235 |
| 68 | Ga0068302_10040115 | 3300005071 | Bacteria | 2198 |
| 69 | Ga0068305_10066936 | 3300005083 | Bacteria | 1730 |
| 70 | Ga0074278_104226 | 3300005721 | Bacteria | 5344 |
| 71 | Ga0466734_103518 | 3300042623 | Bacteria | 1091 |
| 72 | Ga0466709_072115 | 3300042648 | Bacteria | 26950 |
| 73 | Ga0466709_419438 | 3300042648 | Bacteria | 66983 |
| 74 | Ga0466708_313765 | 3300042652 | Bacteria | 17958 |
| 75 | Ga0466708_346126 | 3300042652 | Bacteria | 9125 |
| 76 | Ga0466691_190368 | 3300042593 | Bacteria | 7726 |
| 77 | Ga0466696_279482 | 3300042596 | Bacteria | 1947 |
| 78 | Ga0466711_025702 | 3300042615 | Bacteria | 8443 |
| 79 | Ga0466711_069083 | 3300042615 | Bacteria | 9938 |
| 80 | Ga0466715_349601 | 3300042616 | Bacteria | 20209 |
| 81 | Ga0466715_363163 | 3300042616 | Bacteria | 38882 |
| 82 | Ga0466728_113466 | 3300042620 | Bacteria | 27241 |
| 83 | Ga0123356_10303732 | 3300010049 | Bacteria | 1702 |
| 84 | Ga0123353_10141262 | 3300010167 | Bacteria | 3857 |
| 85 | Ga0123354_10008719 | 3300010882 | Bacteria | 15454 |
| 86 | Ga0466707_121269 | 3300042601 | Bacteria | 14472 |
| 87 | Ga0466707_189292 | 3300042601 | Bacteria | 14701 |
| 88 | Ga0466707_313498 | 3300042601 | Bacteria | 3490 |
| 89 | Ga0466713_013505 | 3300042602 | Bacteria | 10610 |
| 90 | Ga0466717_226122 | 3300042604 | Bacteria | 1657 |
| 91 | Ga0466716_429873 | 3300042605 | Bacteria | 15800 |
| 92 | Ga0466705_110905 | 3300042612 | Bacteria | 4815 |
| 93 | Ga0466705_277600 | 3300042612 | Bacteria | 23173 |
| 94 | Ga0466733_090119 | 3300042659 | Bacteria | 5350 |
| 95 | Ga0466733_094807 | 3300042659 | Bacteria | 2567 |
| 96 | Ga0466733_200653 | 3300042659 | Bacteria | 1412 |
| 97 | Ga0466733_209232 | 3300042659 | Bacteria | 28030 |
| 98 | 2227563235 | 2225789004 | Bacteria | 2697 |
| 99 | IMNBL1DRAFT_c0001282 | 3300000062 | Bacteria | 18930 |
| 100 | JGI24702J35022_10039406 | 3300002462 | Bacteria | 2521 |
| 101 | Ga0466734_115655 | 3300042623 | Bacteria | 2373 |
| 102 | Ga0466703_086784 | 3300042636 | Bacteria | 11764 |
| 103 | Ga0466703_291422 | 3300042636 | Bacteria | 15765 |
| 104 | Ga0466703_309653 | 3300042636 | Bacteria | 2250 |
| 105 | Ga0466708_119023 | 3300042652 | Bacteria | 10074 |
| 106 | Ga0466725_184362 | 3300042654 | Bacteria | 6806 |
| 107 | Ga0466690_391289 | 3300042590 | Bacteria | 25345 |
| 108 | Ga0466695_247647 | 3300042595 | Bacteria | 1545 |
| 109 | Ga0466696_168682 | 3300042596 | Bacteria | 17271 |
| 110 | Ga0466711_255353 | 3300042615 | Bacteria | 15249 |
| 111 | Ga0466726_039869 | 3300042619 | Unclassified | 3232 |
| 112 | Ga0466726_395614 | 3300042619 | Bacteria | 5007 |
| 113 | Ga0466729_081356 | 3300042621 | Bacteria | 12361 |
| 114 | Ga0123357_10471790 | 3300009784 | Bacteria | 1069 |
| 115 | Ga0123356_10005664 | 3300010049 | Bacteria | 12686 |
| 116 | Ga0123356_10017307 | 3300010049 | Bacteria | 6857 |
| 117 | Ga0123353_10768406 | 3300010167 | Bacteria | 1337 |
| 118 | Ga0466707_413838 | 3300042601 | Bacteria | 9602 |
| 119 | Ga0466713_008762 | 3300042602 | Bacteria | 34128 |
| 120 | Ga0466713_148996 | 3300042602 | Bacteria | 2314 |
| 121 | Ga0466716_335343 | 3300042605 | Bacteria | 11355 |
| 122 | Ga0466722_035561 | 3300042609 | Bacteria | 9440 |
| 123 | Ga0466722_148155 | 3300042609 | Bacteria | 1037 |
| 124 | Ga0466705_092074 | 3300042612 | Bacteria | 11963 |
| 125 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 126 | 2227364159 | 2225789004 | Bacteria | 6064 |
| 127 | HBC_ctgsDRAFT_1011438 | 3300000333 | Bacteria | 2120 |
| 128 | JGI24702J35022_10002429 | 3300002462 | Bacteria | 11372 |
| 129 | Ga0068305_10109398 | 3300005083 | Bacteria | 11086 |
| 130 | Ga0466704_205704 | 3300042643 | Bacteria | 10595 |
| 131 | Ga0466704_363108 | 3300042643 | Bacteria | 39184 |
| 132 | Ga0466708_052486 | 3300042652 | Bacteria | 68065 |
| 133 | Ga0160447_115551 | 3300012849 | Bacteria | 1403 |
| 134 | Ga0466656_127057 | 3300042550 | Bacteria | 14863 |
| 135 | Ga0466696_042279 | 3300042596 | Bacteria | 13281 |
| 136 | Ga0466696_276915 | 3300042596 | Bacteria | 10510 |
| 137 | Ga0466699_379263 | 3300042597 | Bacteria | 2978 |
| 138 | Ga0466705_460495 | 3300042612 | Bacteria | 10576 |
| 139 | Ga0466711_098770 | 3300042615 | Bacteria | 6887 |
| 140 | Ga0466711_126406 | 3300042615 | Bacteria | 3441 |
| 141 | Ga0466711_338568 | 3300042615 | Bacteria | 23627 |
| 142 | Ga0123354_10147880 | 3300010882 | Bacteria | 2865 |
| 143 | Ga0466701_099197 | 3300042598 | Bacteria | 41467 |
| 144 | Ga0466706_112575 | 3300042599 | Bacteria | 2798 |
| 145 | Ga0466706_214431 | 3300042599 | Bacteria | 2410 |
| 146 | Ga0466713_110965 | 3300042602 | Bacteria | 66281 |
| 147 | Ga0466717_056262 | 3300042604 | Bacteria | 2618 |
| 148 | Ga0466716_237081 | 3300042605 | Bacteria | 27405 |
| 149 | Ga0466705_202542 | 3300042612 | Bacteria | 10741 |
| 150 | Ga0466733_029771 | 3300042659 | Bacteria | 6594 |
| 151 | Ga0466733_127869 | 3300042659 | Bacteria | 21032 |
| 152 | 2227477695 | 2225789004 | Bacteria | 4571 |
| 153 | JGI24699J35502_11133945 | 3300002509 | Bacteria | 20602 |
| 154 | Ga0068305_10274135 | 3300005083 | Bacteria | 3661 |
| 155 | Ga0466729_229532 | 3300042621 | Bacteria | 1268 |
| 156 | Ga0466734_007771 | 3300042623 | Bacteria | 1770 |
| 157 | Ga0466735_021399 | 3300042624 | Bacteria | 17324 |
| 158 | Ga0466703_060494 | 3300042636 | Bacteria | 13418 |
| 159 | Ga0466703_293757 | 3300042636 | Bacteria | 3197 |
| 160 | Ga0466704_020179 | 3300042643 | Bacteria | 18471 |
| 161 | Ga0466725_228966 | 3300042654 | Bacteria | 7132 |
| 162 | Ga0466727_034358 | 3300042655 | Bacteria | 33712 |
| 163 | Ga0466690_054099 | 3300042590 | Bacteria | 2774 |
| 164 | Ga0466710_051848 | 3300042613 | Bacteria | 1244 |
| 165 | Ga0466711_019117 | 3300042615 | Bacteria | 16431 |
| 166 | Ga0466718_046144 | 3300042617 | Bacteria | 1454 |
| 167 | Ga0466729_107081 | 3300042621 | Bacteria | 5086 |
| 168 | Ga0123355_10107566 | 3300009826 | Bacteria | 4368 |
| 169 | Ga0123356_10197052 | 3300010049 | Bacteria | 2051 |
| 170 | Ga0123356_10932543 | 3300010049 | Bacteria | 1039 |
| 171 | Ga0123353_10060420 | 3300010167 | Bacteria | 6078 |
| 172 | Ga0466706_088639 | 3300042599 | Bacteria | 40015 |
| 173 | Ga0466713_026107 | 3300042602 | Bacteria | 57287 |
| 174 | Ga0466717_078169 | 3300042604 | Bacteria | 1870 |
| 175 | Ga0466698_215583 | 3300042610 | Bacteria | 5116 |
| 176 | Ga0466705_357419 | 3300042612 | Bacteria | 8105 |
| 177 | IMNBL1DRAFT_c0003458 | 3300000062 | Bacteria | 10141 |
| 178 | Ga0103267_1000258 | 3300007190 | Bacteria | 32150 |
| 179 | Ga0466735_142432 | 3300042624 | Bacteria | 4424 |
| 180 | Ga0466730_007382 | 3300042625 | Bacteria | 3700 |
| 181 | Ga0466703_127806 | 3300042636 | Bacteria | 4299 |
| 182 | Ga0466704_258293 | 3300042643 | Bacteria | 8286 |
| 183 | Ga0466709_073659 | 3300042648 | Bacteria | 11222 |
| 184 | Ga0466709_342148 | 3300042648 | Bacteria | 6030 |
| 185 | Ga0466724_15413 | 3300042649 | Bacteria | 1443 |
| 186 | Ga0160456_100616 | 3300012820 | Bacteria | 10605 |
| 187 | Ga0466691_001192 | 3300042593 | Bacteria | 6426 |
| 188 | Ga0466696_454402 | 3300042596 | Bacteria | 1076 |
| 189 | Ga0466728_040355 | 3300042620 | Bacteria | 37896 |
| 190 | Ga0466728_273031 | 3300042620 | Bacteria | 99357 |
| 191 | Ga0123356_10169288 | 3300010049 | Bacteria | 2193 |
| 192 | Ga0123353_10899339 | 3300010167 | Bacteria | 1205 |
| 193 | Ga0123354_10529029 | 3300010882 | Bacteria | 901 |
| 194 | Ga0466706_288578 | 3300042599 | Bacteria | 3779 |
| 195 | Ga0466713_017402 | 3300042602 | Bacteria | 11883 |
| 196 | Ga0466713_109063 | 3300042602 | Bacteria | 21346 |
| 197 | Ga0466717_058552 | 3300042604 | Bacteria | 3798 |
| 198 | Ga0466717_273372 | 3300042604 | Bacteria | 2257 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00834 | Ribul_P_3_epim | Ribulose-phosphate 3 epimerase family | 47 | 244 | 1 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.