Protein Family IF00158
Metagenome
Metatranscriptome
Isolate
407
Members
199
Samples
267
Scaffolds
315.7
Avg Length
Representative Sequence
- ID
- 2225789004|2227533260|2228047377
- Length
- 360 aa
- Sequence
- VFDFNKPKIEITDISEDKKYGRFVVEPLERGYGTTLGNSLRRIMLSSLPGAAVSQVKIEGVLHEFSSIQGVKEDVTEIIMNIKSLAIRNNSETNEPKMAYIEFEGEGVVRASDIQVDSDIEIMNPDLVIATLNGGADSKLYMELTITKGRGYISADKGKSDDMPIGVIAIDAIYTPAERVNLTVENTRVGQITDFDKLTLDVFTNGTLVPDEAVSLAAKVLSEHLKLFIDLSENAKAAEVMIEKEDDEKEKVLEMNIDELELSVRSYNCLKRANINTVEELCNKTSEDMMKVRNLGRKSLEEVLEKLRELGLQLNSGDE*RD*LFVSNSLDNNLGVAKQYGSKTEEACHSVPQMKEIYNG
Sample Types
Isolate
34.4%
Metagenome
64.9%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.9%
Termitidae
16.7%
Drosophilidae
10.4%
Kalotermitidae
7.3%
Blattidae
7.3%
Apidae
3.1%
Scarabaeidae
2.6%
Pyralidae
2.6%
Termopsidae
2.1%
Rhinotermitidae
1.6%
Passalidae
1.6%
Bombycidae
1.0%
Elmidae
1.0%
Tenebrionidae
1.0%
Penaeidae
0.5%
Portunidae
0.5%
Hodotermitidae
0.5%
Noctuidae
0.5%
Eresidae
0.5%
Culicidae
0.5%
Nephropidae
0.5%
Ocypodidae
0.5%
Curculionidae
0.5%
Formicidae
0.5%
Euphausiidae
0.5%
Taxonomy
Archaea
0
Bacteria
386
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 3 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 4 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 5 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 6 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 7 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 8 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 9 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 10 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 11 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 18 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 21 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 22 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 28 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 29 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 30 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 31 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 32 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 33 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 34 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 35 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 36 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 37 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 38 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 39 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 40 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 43 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 44 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 45 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 46 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 47 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 48 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 49 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 50 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 51 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 52 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 53 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 54 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 55 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 56 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 57 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 58 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 59 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 60 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 61 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 62 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 63 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 64 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 65 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 66 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 67 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 68 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 69 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 70 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 71 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 72 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 73 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 74 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 75 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 76 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 77 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 78 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 79 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 80 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 81 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 82 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 83 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 84 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 85 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 86 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 87 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 88 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 89 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 90 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 91 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 92 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 93 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 94 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 95 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 96 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 97 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 98 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 99 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 100 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 101 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 102 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 103 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 104 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 105 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 106 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 107 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 108 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 109 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 110 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 111 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 112 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 113 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 114 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 115 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 116 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 117 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 118 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 119 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 120 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 121 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 122 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 123 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 124 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 125 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 126 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 127 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 128 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 129 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 130 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 131 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 132 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 133 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 134 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 135 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 136 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 137 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 138 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 139 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 140 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 141 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 142 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 143 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 144 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 145 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 146 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 147 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 148 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 149 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 150 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 151 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 152 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 153 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 154 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 155 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 156 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 157 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 158 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 159 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 160 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 161 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 162 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 163 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 164 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 165 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 166 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 167 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 168 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 169 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 170 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 171 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 172 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 173 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 174 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 175 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 176 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 177 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 178 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 179 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 180 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 181 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 182 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 183 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 184 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 185 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 186 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 187 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 188 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 189 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 190 | 3300021192 | Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA | Metatranscriptome | Termitidae |
| 191 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 192 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 193 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 194 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 195 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 196 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 197 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 198 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 199 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_261073 | 3300042612 | Bacteria | 35670 |
| 2 | Ga0466733_034524 | 3300042659 | Unclassified | 2099 |
| 3 | Ga0466733_077697 | 3300042659 | Bacteria | 1286 |
| 4 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 5 | Ga0466715_321032 | 3300042616 | Bacteria | 166710 |
| 6 | Ga0466723_344622 | 3300042618 | Bacteria | 35563 |
| 7 | Ga0123355_10001096 | 3300009826 | Bacteria | 37400 |
| 8 | Ga0123355_10001471 | 3300009826 | Bacteria | 32759 |
| 9 | Ga0123355_10090942 | 3300009826 | Bacteria | 4840 |
| 10 | Ga0123355_10173988 | 3300009826 | Bacteria | 3211 |
| 11 | Ga0123355_10307856 | 3300009826 | Bacteria | 2151 |
| 12 | Ga0123355_10375566 | 3300009826 | Unclassified | 1858 |
| 13 | Ga0123355_10387951 | 3300009826 | Bacteria | 1813 |
| 14 | Ga0123355_10454624 | 3300009826 | Bacteria | 1611 |
| 15 | Ga0123356_10025396 | 3300010049 | Bacteria | 5569 |
| 16 | Ga0123356_10302301 | 3300010049 | Bacteria | 1705 |
| 17 | Ga0123353_10015815 | 3300010167 | Unclassified | 10989 |
| 18 | Ga0466706_259750 | 3300042599 | Bacteria | 1589 |
| 19 | Ga0466713_060726 | 3300042602 | Bacteria | 22614 |
| 20 | Ga0466719_011138 | 3300042606 | Unclassified | 1941 |
| 21 | Ga0466721_139283 | 3300042608 | Bacteria | 240312 |
| 22 | Ga0466722_062688 | 3300042609 | Bacteria | 114214 |
| 23 | Ga0466729_225465 | 3300042621 | Unclassified | 5311 |
| 24 | Ga0466703_254472 | 3300042636 | Bacteria | 9059 |
| 25 | Ga0466704_237378 | 3300042643 | Bacteria | 3362 |
| 26 | Ga0466709_346362 | 3300042648 | Bacteria | 31912 |
| 27 | Ga0466712_162096 | 3300042614 | Bacteria | 3363 |
| 28 | Ga0466711_130502 | 3300042615 | Unclassified | 2367 |
| 29 | Ga0466715_586856 | 3300042616 | Bacteria | 1784 |
| 30 | Ga0466715_642022 | 3300042616 | Bacteria | 7468 |
| 31 | Ga0466723_070726 | 3300042618 | Bacteria | 1306 |
| 32 | Ga0466723_111142 | 3300042618 | Bacteria | 3761 |
| 33 | Ga0415639_046436 | 3300038395 | Bacteria | 1458 |
| 34 | Ga0123357_10106134 | 3300009784 | Bacteria | 3602 |
| 35 | Ga0123355_10004431 | 3300009826 | Bacteria | 20424 |
| 36 | Ga0123355_10037361 | 3300009826 | Bacteria | 7897 |
| 37 | Ga0123355_10214434 | 3300009826 | Bacteria | 2782 |
| 38 | Ga0123355_10332864 | 3300009826 | Bacteria | 2032 |
| 39 | Ga0123355_10411454 | 3300009826 | Bacteria | 1736 |
| 40 | Ga0123355_10619911 | 3300009826 | Bacteria | 1276 |
| 41 | Ga0123355_10826023 | 3300009826 | Bacteria | 1026 |
| 42 | Ga0123356_10002105 | 3300010049 | Bacteria | 21469 |
| 43 | Ga0123356_10215872 | 3300010049 | Bacteria | 1971 |
| 44 | Ga0123353_10000294 | 3300010167 | Bacteria | 62045 |
| 45 | Ga0123353_10088307 | 3300010167 | Bacteria | 4993 |
| 46 | Ga0123353_10204187 | 3300010167 | Unclassified | 3106 |
| 47 | Ga0123353_10603007 | 3300010167 | Bacteria | 1569 |
| 48 | Ga0466706_139602 | 3300042599 | Unclassified | 1009 |
| 49 | Ga0466706_269670 | 3300042599 | Bacteria | 79639 |
| 50 | Ga0466722_245758 | 3300042609 | Bacteria | 8085 |
| 51 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 52 | Ga0466730_068452 | 3300042625 | Unclassified | 2882 |
| 53 | Ga0466702_005196 | 3300042635 | Bacteria | 8486 |
| 54 | 2212886490 | 2209111004 | Bacteria | 17554 |
| 55 | 2227253017 | 2225789004 | Bacteria | 7106 |
| 56 | 2227533260 | 2225789004 | Bacteria | 3108 |
| 57 | 2227555755 | 2225789004 | Bacteria | 2790 |
| 58 | IMNBL1DRAFT_c0021346 | 3300000062 | Unclassified | 2594 |
| 59 | Ga0072941_1050142 | 3300005201 | Bacteria | 6062 |
| 60 | Ga0072941_1233089 | 3300005201 | Bacteria | 4881 |
| 61 | Ga0466733_112366 | 3300042659 | Bacteria | 13433 |
| 62 | Ga0466733_135225 | 3300042659 | Bacteria | 3964 |
| 63 | Ga0466711_150217 | 3300042615 | Bacteria | 5364 |
| 64 | Ga0466718_089576 | 3300042617 | Bacteria | 1281 |
| 65 | Ga0466726_051866 | 3300042619 | Bacteria | 8985 |
| 66 | Ga0466726_129712 | 3300042619 | Bacteria | 4300 |
| 67 | Ga0466726_292887 | 3300042619 | Bacteria | 2811 |
| 68 | Ga0466726_324507 | 3300042619 | Bacteria | 16558 |
| 69 | Ga0222432_1010180 | 3300021192 | Bacteria | 1176 |
| 70 | Ga0415639_222081 | 3300038395 | Bacteria | 1460 |
| 71 | Ga0466696_026574 | 3300042596 | Bacteria | 48163 |
| 72 | Ga0466696_498562 | 3300042596 | Bacteria | 15998 |
| 73 | Ga0123357_10452983 | 3300009784 | Bacteria | 1111 |
| 74 | Ga0123355_10002506 | 3300009826 | Bacteria | 26020 |
| 75 | Ga0123355_10036685 | 3300009826 | Bacteria | 7970 |
| 76 | Ga0123355_10246231 | 3300009826 | Bacteria | 2524 |
| 77 | Ga0123355_10248626 | 3300009826 | Bacteria | 2507 |
| 78 | Ga0123355_10409528 | 3300009826 | Bacteria | 1742 |
| 79 | Ga0123355_10744040 | 3300009826 | Bacteria | 1111 |
| 80 | Ga0123356_10522111 | 3300010049 | Bacteria | 1346 |
| 81 | Ga0123353_10014428 | 3300010167 | Bacteria | 11391 |
| 82 | Ga0123353_10024071 | 3300010167 | Bacteria | 9235 |
| 83 | Ga0123353_10061044 | 3300010167 | Bacteria | 6045 |
| 84 | Ga0123353_10346429 | 3300010167 | Bacteria | 2241 |
| 85 | Ga0123354_10164506 | 3300010882 | Bacteria | 2615 |
| 86 | Ga0466719_002828 | 3300042606 | Bacteria | 4592 |
| 87 | Ga0466719_381029 | 3300042606 | Bacteria | 20568 |
| 88 | Ga0466702_362163 | 3300042635 | Unclassified | 3759 |
| 89 | Ga0466704_292981 | 3300042643 | Unclassified | 1521 |
| 90 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 91 | Ga0068302_10568064 | 3300005071 | Bacteria | 1501 |
| 92 | Ga0466705_061344 | 3300042612 | Bacteria | 17468 |
| 93 | Ga0466705_296260 | 3300042612 | Bacteria | 2095 |
| 94 | Ga0466733_091171 | 3300042659 | Bacteria | 20195 |
| 95 | Ga0466705_464520 | 3300042612 | Bacteria | 1152 |
| 96 | Ga0466711_011987 | 3300042615 | Bacteria | 7745 |
| 97 | Ga0466715_416878 | 3300042616 | Bacteria | 48123 |
| 98 | Ga0466718_051532 | 3300042617 | Bacteria | 2073 |
| 99 | Ga0466723_176919 | 3300042618 | Bacteria | 1687 |
| 100 | Ga0466726_119686 | 3300042619 | Bacteria | 3919 |
| 101 | Ga0415639_026367 | 3300038395 | Bacteria | 19858 |
| 102 | Ga0415639_027175 | 3300038395 | Bacteria | 16778 |
| 103 | Ga0415639_029799 | 3300038395 | Bacteria | 5819 |
| 104 | Ga0415639_038928 | 3300038395 | Bacteria | 1419 |
| 105 | Ga0415639_099932 | 3300038395 | Bacteria | 3237 |
| 106 | Ga0466690_112788 | 3300042590 | Bacteria | 5735 |
| 107 | Ga0123355_10001203 | 3300009826 | Bacteria | 36038 |
| 108 | Ga0123355_10025831 | 3300009826 | Bacteria | 9461 |
| 109 | Ga0123355_10096992 | 3300009826 | Bacteria | 4654 |
| 110 | Ga0123355_10296831 | 3300009826 | Bacteria | 2209 |
| 111 | Ga0123355_10434745 | 3300009826 | Bacteria | 1666 |
| 112 | Ga0123356_10045197 | 3300010049 | Bacteria | 4098 |
| 113 | Ga0123353_10012432 | 3300010167 | Bacteria | 12102 |
| 114 | Ga0123353_10070317 | 3300010167 | Bacteria | 5623 |
| 115 | Ga0123353_10248279 | 3300010167 | Bacteria | 2759 |
| 116 | Ga0123353_10527261 | 3300010167 | Bacteria | 1711 |
| 117 | Ga0123354_10224560 | 3300010882 | Bacteria | 1984 |
| 118 | Ga0466706_103864 | 3300042599 | Bacteria | 13046 |
| 119 | Ga0466700_149744 | 3300042600 | Bacteria | 1356 |
| 120 | Ga0466714_017536 | 3300042603 | Bacteria | 6524 |
| 121 | Ga0466719_203918 | 3300042606 | Bacteria | 15671 |
| 122 | Ga0466702_123653 | 3300042635 | Bacteria | 2718 |
| 123 | Ga0466702_160104 | 3300042635 | Bacteria | 1926 |
| 124 | Ga0466702_170219 | 3300042635 | Bacteria | 2412 |
| 125 | Ga0466703_055944 | 3300042636 | Bacteria | 1712 |
| 126 | Ga0466704_322227 | 3300042643 | Bacteria | 202158 |
| 127 | Ga0466704_333763 | 3300042643 | Bacteria | 67469 |
| 128 | Ga0466704_420260 | 3300042643 | Bacteria | 3123 |
| 129 | Ga0466704_505834 | 3300042643 | Bacteria | 17390 |
| 130 | 2227512975 | 2225789004 | Bacteria | 3512 |
| 131 | IMNBL1DRAFT_c0000921 | 3300000062 | Bacteria | 22740 |
| 132 | IMNBL1DRAFT_c0001685 | 3300000062 | Bacteria | 16309 |
| 133 | JGI24702J35022_10037161 | 3300002462 | Bacteria | 2601 |
| 134 | JGI24700J35501_10913919 | 3300002508 | Bacteria | 3805 |
| 135 | Ga0068305_10002308 | 3300005083 | Bacteria | 45236 |
| 136 | Ga0562378_1934 | 3300056814 | Bacteria | 19745 |
| 137 | Ga0466715_232257 | 3300042616 | Bacteria | 9357 |
| 138 | Ga0466715_462559 | 3300042616 | Bacteria | 14908 |
| 139 | Ga0466715_535036 | 3300042616 | Bacteria | 4236 |
| 140 | Ga0223688_1021784 | 3300021227 | Bacteria | 1382 |
| 141 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
| 142 | Ga0466691_206597 | 3300042593 | Bacteria | 4586 |
| 143 | Ga0466696_296201 | 3300042596 | Bacteria | 26567 |
| 144 | Ga0123357_10361502 | 3300009784 | Bacteria | 1374 |
| 145 | Ga0123355_10222639 | 3300009826 | Bacteria | 2710 |
| 146 | Ga0123355_10362771 | 3300009826 | Bacteria | 1907 |
| 147 | Ga0123355_10674429 | 3300009826 | Bacteria | 1197 |
| 148 | Ga0123356_10055337 | 3300010049 | Bacteria | 3695 |
| 149 | Ga0123356_10163707 | 3300010049 | Bacteria | 2225 |
| 150 | Ga0123356_10177089 | 3300010049 | Bacteria | 2150 |
| 151 | Ga0123356_10320696 | 3300010049 | Bacteria | 1662 |
| 152 | Ga0123353_10007862 | 3300010167 | Bacteria | 14483 |
| 153 | Ga0123353_10254878 | 3300010167 | Bacteria | 2714 |
| 154 | Ga0123353_10314228 | 3300010167 | Bacteria | 2382 |
| 155 | Ga0123353_10404891 | 3300010167 | Unclassified | 2029 |
| 156 | Ga0123353_10426012 | 3300010167 | Bacteria | 1964 |
| 157 | Ga0123353_10858693 | 3300010167 | Unclassified | 1243 |
| 158 | Ga0123354_10106745 | 3300010882 | Bacteria | 3735 |
| 159 | Ga0466706_107205 | 3300042599 | Bacteria | 176653 |
| 160 | Ga0466706_113164 | 3300042599 | Bacteria | 25442 |
| 161 | Ga0466706_237075 | 3300042599 | Bacteria | 3711 |
| 162 | Ga0466713_014023 | 3300042602 | Bacteria | 32520 |
| 163 | Ga0466714_118714 | 3300042603 | Bacteria | 2104 |
| 164 | Ga0466722_045557 | 3300042609 | Bacteria | 252817 |
| 165 | Ga0466722_177812 | 3300042609 | Bacteria | 2070 |
| 166 | Ga0466722_189450 | 3300042609 | Bacteria | 5051 |
| 167 | Ga0466735_050127 | 3300042624 | Bacteria | 1690 |
| 168 | Ga0466709_418632 | 3300042648 | Bacteria | 47357 |
| 169 | Ga0466724_20354 | 3300042649 | Bacteria | 4602 |
| 170 | Ga0466725_414537 | 3300042654 | Bacteria | 1460 |
| 171 | Ga0466727_054865 | 3300042655 | Bacteria | 148022 |
| 172 | 2227155796 | 2225789004 | Bacteria | 8466 |
| 173 | 2227324681 | 2225789004 | Bacteria | 1182 |
| 174 | 2227625483 | 2225789004 | Bacteria | 2158 |
| 175 | JGI24700J35501_10927796 | 3300002508 | Bacteria | 7078 |
| 176 | Ga0466715_188812 | 3300042616 | Bacteria | 9135 |
| 177 | Ga0466715_576847 | 3300042616 | Unclassified | 2571 |
| 178 | Ga0466728_218198 | 3300042620 | Bacteria | 17528 |
| 179 | Ga0466728_452942 | 3300042620 | Bacteria | 39308 |
| 180 | Ga0466729_179085 | 3300042621 | Bacteria | 60360 |
| 181 | Ga0466696_484385 | 3300042596 | Unclassified | 1415 |
| 182 | Ga0123355_10001065 | 3300009826 | Bacteria | 37847 |
| 183 | Ga0123355_10001214 | 3300009826 | Bacteria | 35876 |
| 184 | Ga0123355_10045502 | 3300009826 | Bacteria | 7139 |
| 185 | Ga0123355_10090773 | 3300009826 | Bacteria | 4844 |
| 186 | Ga0123355_10548888 | 3300009826 | Bacteria | 1398 |
| 187 | Ga0123355_10590983 | 3300009826 | Bacteria | 1322 |
| 188 | Ga0123355_10647816 | 3300009826 | Bacteria | 1234 |
| 189 | Ga0123353_10085480 | 3300010167 | Bacteria | 5080 |
| 190 | Ga0123353_10298821 | 3300010167 | Bacteria | 2459 |
| 191 | Ga0123353_10335486 | 3300010167 | Bacteria | 2286 |
| 192 | Ga0466713_006906 | 3300042602 | Bacteria | 112453 |
| 193 | Ga0466714_067406 | 3300042603 | Bacteria | 1179 |
| 194 | Ga0466734_069216 | 3300042623 | Bacteria | 3556 |
| 195 | Ga0466730_095014 | 3300042625 | Bacteria | 15821 |
| 196 | Ga0466708_135960 | 3300042652 | Bacteria | 21988 |
| 197 | Ga0466725_069889 | 3300042654 | Bacteria | 3786 |
| 198 | Ga0466725_224368 | 3300042654 | Bacteria | 9572 |
| 199 | Ga0466725_306121 | 3300042654 | Bacteria | 2646 |
| 200 | Ga0466725_357234 | 3300042654 | Unclassified | 4521 |
| 201 | 2227191891 | 2225789004 | Bacteria | 35154 |
| 202 | 2227507959 | 2225789004 | Bacteria | 65570 |
| 203 | 2227591299 | 2225789004 | Bacteria | 12952 |
| 204 | JGI24702J35022_10013656 | 3300002462 | Bacteria | 4493 |
| 205 | JGI24700J35501_10930794 | 3300002508 | Bacteria | 24253 |
| 206 | Ga0063521_1000130 | 3300003973 | Bacteria | 58438 |
| 207 | Ga0466705_059743 | 3300042612 | Bacteria | 8308 |
| 208 | Ga0466715_309594 | 3300042616 | Bacteria | 109113 |
| 209 | Ga0466726_481459 | 3300042619 | Bacteria | 3855 |
| 210 | Ga0223687_100023 | 3300021217 | Unclassified | 1925 |
| 211 | Ga0466690_182907 | 3300042590 | Unclassified | 1312 |
| 212 | Ga0466690_253031 | 3300042590 | Bacteria | 3644 |
| 213 | Ga0466690_281913 | 3300042590 | Bacteria | 36067 |
| 214 | Ga0123355_10004905 | 3300009826 | Bacteria | 19468 |
| 215 | Ga0123355_10024983 | 3300009826 | Bacteria | 9615 |
| 216 | Ga0123355_10035834 | 3300009826 | Bacteria | 8066 |
| 217 | Ga0123355_10334694 | 3300009826 | Bacteria | 2024 |
| 218 | Ga0123355_10376686 | 3300009826 | Bacteria | 1854 |
| 219 | Ga0123355_10727614 | 3300009826 | Bacteria | 1130 |
| 220 | Ga0123356_10011608 | 3300010049 | Bacteria | 8584 |
| 221 | Ga0123356_10079691 | 3300010049 | Bacteria | 3094 |
| 222 | Ga0123356_10087799 | 3300010049 | Bacteria | 2955 |
| 223 | Ga0123353_10085268 | 3300010167 | Bacteria | 5086 |
| 224 | Ga0123353_10115883 | 3300010167 | Bacteria | 4312 |
| 225 | Ga0123353_10267324 | 3300010167 | Bacteria | 2637 |
| 226 | Ga0123353_10559822 | 3300010167 | Bacteria | 1646 |
| 227 | Ga0466714_012747 | 3300042603 | Bacteria | 29171 |
| 228 | Ga0466719_131463 | 3300042606 | Bacteria | 1690 |
| 229 | Ga0466722_133312 | 3300042609 | Bacteria | 2502 |
| 230 | Ga0466734_119789 | 3300042623 | Bacteria | 17928 |
| 231 | Ga0466704_107009 | 3300042643 | Bacteria | 7254 |
| 232 | Ga0466724_26922 | 3300042649 | Bacteria | 2522 |
| 233 | Ga0466708_164450 | 3300042652 | Bacteria | 37163 |
| 234 | Ga0466725_082702 | 3300042654 | Bacteria | 32093 |
| 235 | Ga0466727_289823 | 3300042655 | Bacteria | 3236 |
| 236 | 2227013722 | 2225789003 | Unclassified | 5360 |
| 237 | IMNBL1DRAFT_c0000272 | 3300000062 | Bacteria | 45809 |
| 238 | IMNBL1DRAFT_c0003266 | 3300000062 | Bacteria | 10568 |
| 239 | AustNasuHG_c1025050 | 3300000089 | Bacteria | 1881 |
| 240 | JGI24695J34938_10001623 | 3300002450 | Bacteria | 18771 |
| 241 | Ga0466710_117340 | 3300042613 | Bacteria | 3301 |
| 242 | Ga0466711_274923 | 3300042615 | Bacteria | 5249 |
| 243 | Ga0466726_214965 | 3300042619 | Bacteria | 31160 |
| 244 | Ga0466728_208642 | 3300042620 | Bacteria | 62806 |
| 245 | Ga0466691_048976 | 3300042593 | Bacteria | 70909 |
| 246 | Ga0123355_10263420 | 3300009826 | Bacteria | 2407 |
| 247 | Ga0123355_10285081 | 3300009826 | Bacteria | 2274 |
| 248 | Ga0123355_10599806 | 3300009826 | Bacteria | 1307 |
| 249 | Ga0123356_10024887 | 3300010049 | Bacteria | 5628 |
| 250 | Ga0123356_10182675 | 3300010049 | Bacteria | 2121 |
| 251 | Ga0123353_10003404 | 3300010167 | Bacteria | 20101 |
| 252 | Ga0123353_10272800 | 3300010167 | Bacteria | 2604 |
| 253 | Ga0123354_10098977 | 3300010882 | Bacteria | 3961 |
| 254 | Ga0466706_121576 | 3300042599 | Bacteria | 1755 |
| 255 | Ga0466706_152943 | 3300042599 | Bacteria | 48130 |
| 256 | Ga0466707_192483 | 3300042601 | Bacteria | 2932 |
| 257 | Ga0466714_136654 | 3300042603 | Bacteria | 17666 |
| 258 | Ga0466716_189379 | 3300042605 | Bacteria | 7789 |
| 259 | Ga0466719_101917 | 3300042606 | Bacteria | 4223 |
| 260 | Ga0466697_013057 | 3300042611 | Bacteria | 1730 |
| 261 | Ga0466709_152308 | 3300042648 | Bacteria | 15669 |
| 262 | Ga0466727_125041 | 3300042655 | Bacteria | 24880 |
| 263 | Ga0466727_200110 | 3300042655 | Bacteria | 19231 |
| 264 | 2227524627 | 2225789004 | Unclassified | 16957 |
| 265 | IMNBL1DRAFT_c0003830 | 3300000062 | Bacteria | 9372 |
| 266 | IMNBL1DRAFT_c0021541 | 3300000062 | Bacteria | 2577 |
| 267 | JGI24703J35330_11738853 | 3300002501 | Bacteria | 3239 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.