Protein Family IF00158

Metagenome Metatranscriptome Isolate
407 Members
199 Samples
267 Scaffolds
315.7 Avg Length

🧬 Representative Sequence

ID
2225789004|2227533260|2228047377
Length
360 aa
Sequence
VFDFNKPKIEITDISEDKKYGRFVVEPLERGYGTTLGNSLRRIMLSSLPGAAVSQVKIEGVLHEFSSIQGVKEDVTEIIMNIKSLAIRNNSETNEPKMAYIEFEGEGVVRASDIQVDSDIEIMNPDLVIATLNGGADSKLYMELTITKGRGYISADKGKSDDMPIGVIAIDAIYTPAERVNLTVENTRVGQITDFDKLTLDVFTNGTLVPDEAVSLAAKVLSEHLKLFIDLSENAKAAEVMIEKEDDEKEKVLEMNIDELELSVRSYNCLKRANINTVEELCNKTSEDMMKVRNLGRKSLEEVLEKLRELGLQLNSGDE*RD*LFVSNSLDNNLGVAKQYGSKTEEACHSVPQMKEIYNG

πŸ“Š Sample Types

Isolate 34.4%
Metagenome 64.9%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 35.9%
Termitidae 16.7%
Drosophilidae 10.4%
Kalotermitidae 7.3%
Blattidae 7.3%
Apidae 3.1%
Scarabaeidae 2.6%
Pyralidae 2.6%
Termopsidae 2.1%
Rhinotermitidae 1.6%
Passalidae 1.6%
Bombycidae 1.0%
Elmidae 1.0%
Tenebrionidae 1.0%
Penaeidae 0.5%
Portunidae 0.5%
Hodotermitidae 0.5%
Noctuidae 0.5%
Eresidae 0.5%
Culicidae 0.5%
Nephropidae 0.5%
Ocypodidae 0.5%
Curculionidae 0.5%
Formicidae 0.5%
Euphausiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 386
Eukaryota 0
Viruses 0
Unclassified 21

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
2 2590828840 Clostridium sp. 2 Isolate Termitidae
3 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
4 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
5 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
6 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
7 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
8 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
9 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
10 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
11 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
18 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
19 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
20 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
21 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
22 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
28 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
29 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
30 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
31 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
32 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
33 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
34 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
35 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
36 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
37 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
38 8064008355 Heyndrickxia oleronia Isolate Unclassified
39 8082023105 Niallia sp. Man26 Isolate Penaeidae
40 2969145278 Bacillus cereus 29 Isolate Portunidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
43 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
44 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
45 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
46 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
47 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
48 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
49 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
50 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
51 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
52 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
53 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
54 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
55 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
56 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
57 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
58 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
59 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
60 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
61 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
62 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
63 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
64 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
65 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
66 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
67 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
68 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
69 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
70 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
71 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
72 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
73 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
74 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
75 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
76 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
77 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
78 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
79 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
80 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
81 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
82 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
83 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
84 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
85 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
86 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
87 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
88 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
89 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
90 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
91 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
92 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
93 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
94 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
95 8022725327 Bacillus sp. SN10 Isolate Eresidae
96 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
97 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
98 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
99 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
100 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
101 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
102 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
103 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
104 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
105 2916858470 Heyndrickxia oleronia Isolate Unclassified
106 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
107 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
108 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
109 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
110 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
111 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
112 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
113 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
114 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
115 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
116 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
117 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
118 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
119 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
120 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
121 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
122 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
123 8012112996 Staphylococcus muscae ATCC 49910 Isolate
124 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
125 2978778678 Bacillus cereus 25 Isolate Ocypodidae
126 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
127 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
128 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
129 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
130 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
131 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
132 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
133 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
134 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
135 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
136 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
137 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
138 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
139 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
140 2593339125 Clostridium sp. 5 Isolate Termitidae
141 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
142 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
143 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
144 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
145 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
146 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
147 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
148 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
149 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
150 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
151 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
152 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
153 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
154 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
155 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
156 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
157 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
158 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
159 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
160 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
161 2820545146 Unclassified Firmicutes Lab288P1bin104 Isolate Unclassified
162 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
163 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
164 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
165 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
166 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
167 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
168 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
169 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
170 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
171 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
172 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
173 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
174 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
175 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
176 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
177 8112490586 Staphylococcus muscae CCM 4175 Isolate
178 2537562000 Bacillus cereus HD73 Isolate Pyralidae
179 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
180 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
181 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
182 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
183 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
184 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
185 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
186 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
187 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
188 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
189 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
190 3300021192 Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA Metatranscriptome Termitidae
191 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
192 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
193 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
194 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
195 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
196 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
197 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
198 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
199 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_261073 3300042612 Bacteria 35670
2 Ga0466733_034524 3300042659 Unclassified 2099
3 Ga0466733_077697 3300042659 Bacteria 1286
4 Ga0562377_0006 3300056842 Bacteria 3350072
5 Ga0466715_321032 3300042616 Bacteria 166710
6 Ga0466723_344622 3300042618 Bacteria 35563
7 Ga0123355_10001096 3300009826 Bacteria 37400
8 Ga0123355_10001471 3300009826 Bacteria 32759
9 Ga0123355_10090942 3300009826 Bacteria 4840
10 Ga0123355_10173988 3300009826 Bacteria 3211
11 Ga0123355_10307856 3300009826 Bacteria 2151
12 Ga0123355_10375566 3300009826 Unclassified 1858
13 Ga0123355_10387951 3300009826 Bacteria 1813
14 Ga0123355_10454624 3300009826 Bacteria 1611
15 Ga0123356_10025396 3300010049 Bacteria 5569
16 Ga0123356_10302301 3300010049 Bacteria 1705
17 Ga0123353_10015815 3300010167 Unclassified 10989
18 Ga0466706_259750 3300042599 Bacteria 1589
19 Ga0466713_060726 3300042602 Bacteria 22614
20 Ga0466719_011138 3300042606 Unclassified 1941
21 Ga0466721_139283 3300042608 Bacteria 240312
22 Ga0466722_062688 3300042609 Bacteria 114214
23 Ga0466729_225465 3300042621 Unclassified 5311
24 Ga0466703_254472 3300042636 Bacteria 9059
25 Ga0466704_237378 3300042643 Bacteria 3362
26 Ga0466709_346362 3300042648 Bacteria 31912
27 Ga0466712_162096 3300042614 Bacteria 3363
28 Ga0466711_130502 3300042615 Unclassified 2367
29 Ga0466715_586856 3300042616 Bacteria 1784
30 Ga0466715_642022 3300042616 Bacteria 7468
31 Ga0466723_070726 3300042618 Bacteria 1306
32 Ga0466723_111142 3300042618 Bacteria 3761
33 Ga0415639_046436 3300038395 Bacteria 1458
34 Ga0123357_10106134 3300009784 Bacteria 3602
35 Ga0123355_10004431 3300009826 Bacteria 20424
36 Ga0123355_10037361 3300009826 Bacteria 7897
37 Ga0123355_10214434 3300009826 Bacteria 2782
38 Ga0123355_10332864 3300009826 Bacteria 2032
39 Ga0123355_10411454 3300009826 Bacteria 1736
40 Ga0123355_10619911 3300009826 Bacteria 1276
41 Ga0123355_10826023 3300009826 Bacteria 1026
42 Ga0123356_10002105 3300010049 Bacteria 21469
43 Ga0123356_10215872 3300010049 Bacteria 1971
44 Ga0123353_10000294 3300010167 Bacteria 62045
45 Ga0123353_10088307 3300010167 Bacteria 4993
46 Ga0123353_10204187 3300010167 Unclassified 3106
47 Ga0123353_10603007 3300010167 Bacteria 1569
48 Ga0466706_139602 3300042599 Unclassified 1009
49 Ga0466706_269670 3300042599 Bacteria 79639
50 Ga0466722_245758 3300042609 Bacteria 8085
51 Ga0466729_287045 3300042621 Bacteria 99069
52 Ga0466730_068452 3300042625 Unclassified 2882
53 Ga0466702_005196 3300042635 Bacteria 8486
54 2212886490 2209111004 Bacteria 17554
55 2227253017 2225789004 Bacteria 7106
56 2227533260 2225789004 Bacteria 3108
57 2227555755 2225789004 Bacteria 2790
58 IMNBL1DRAFT_c0021346 3300000062 Unclassified 2594
59 Ga0072941_1050142 3300005201 Bacteria 6062
60 Ga0072941_1233089 3300005201 Bacteria 4881
61 Ga0466733_112366 3300042659 Bacteria 13433
62 Ga0466733_135225 3300042659 Bacteria 3964
63 Ga0466711_150217 3300042615 Bacteria 5364
64 Ga0466718_089576 3300042617 Bacteria 1281
65 Ga0466726_051866 3300042619 Bacteria 8985
66 Ga0466726_129712 3300042619 Bacteria 4300
67 Ga0466726_292887 3300042619 Bacteria 2811
68 Ga0466726_324507 3300042619 Bacteria 16558
69 Ga0222432_1010180 3300021192 Bacteria 1176
70 Ga0415639_222081 3300038395 Bacteria 1460
71 Ga0466696_026574 3300042596 Bacteria 48163
72 Ga0466696_498562 3300042596 Bacteria 15998
73 Ga0123357_10452983 3300009784 Bacteria 1111
74 Ga0123355_10002506 3300009826 Bacteria 26020
75 Ga0123355_10036685 3300009826 Bacteria 7970
76 Ga0123355_10246231 3300009826 Bacteria 2524
77 Ga0123355_10248626 3300009826 Bacteria 2507
78 Ga0123355_10409528 3300009826 Bacteria 1742
79 Ga0123355_10744040 3300009826 Bacteria 1111
80 Ga0123356_10522111 3300010049 Bacteria 1346
81 Ga0123353_10014428 3300010167 Bacteria 11391
82 Ga0123353_10024071 3300010167 Bacteria 9235
83 Ga0123353_10061044 3300010167 Bacteria 6045
84 Ga0123353_10346429 3300010167 Bacteria 2241
85 Ga0123354_10164506 3300010882 Bacteria 2615
86 Ga0466719_002828 3300042606 Bacteria 4592
87 Ga0466719_381029 3300042606 Bacteria 20568
88 Ga0466702_362163 3300042635 Unclassified 3759
89 Ga0466704_292981 3300042643 Unclassified 1521
90 IMNBL1DRAFT_c0000019 3300000062 Bacteria 170255
91 Ga0068302_10568064 3300005071 Bacteria 1501
92 Ga0466705_061344 3300042612 Bacteria 17468
93 Ga0466705_296260 3300042612 Bacteria 2095
94 Ga0466733_091171 3300042659 Bacteria 20195
95 Ga0466705_464520 3300042612 Bacteria 1152
96 Ga0466711_011987 3300042615 Bacteria 7745
97 Ga0466715_416878 3300042616 Bacteria 48123
98 Ga0466718_051532 3300042617 Bacteria 2073
99 Ga0466723_176919 3300042618 Bacteria 1687
100 Ga0466726_119686 3300042619 Bacteria 3919
101 Ga0415639_026367 3300038395 Bacteria 19858
102 Ga0415639_027175 3300038395 Bacteria 16778
103 Ga0415639_029799 3300038395 Bacteria 5819
104 Ga0415639_038928 3300038395 Bacteria 1419
105 Ga0415639_099932 3300038395 Bacteria 3237
106 Ga0466690_112788 3300042590 Bacteria 5735
107 Ga0123355_10001203 3300009826 Bacteria 36038
108 Ga0123355_10025831 3300009826 Bacteria 9461
109 Ga0123355_10096992 3300009826 Bacteria 4654
110 Ga0123355_10296831 3300009826 Bacteria 2209
111 Ga0123355_10434745 3300009826 Bacteria 1666
112 Ga0123356_10045197 3300010049 Bacteria 4098
113 Ga0123353_10012432 3300010167 Bacteria 12102
114 Ga0123353_10070317 3300010167 Bacteria 5623
115 Ga0123353_10248279 3300010167 Bacteria 2759
116 Ga0123353_10527261 3300010167 Bacteria 1711
117 Ga0123354_10224560 3300010882 Bacteria 1984
118 Ga0466706_103864 3300042599 Bacteria 13046
119 Ga0466700_149744 3300042600 Bacteria 1356
120 Ga0466714_017536 3300042603 Bacteria 6524
121 Ga0466719_203918 3300042606 Bacteria 15671
122 Ga0466702_123653 3300042635 Bacteria 2718
123 Ga0466702_160104 3300042635 Bacteria 1926
124 Ga0466702_170219 3300042635 Bacteria 2412
125 Ga0466703_055944 3300042636 Bacteria 1712
126 Ga0466704_322227 3300042643 Bacteria 202158
127 Ga0466704_333763 3300042643 Bacteria 67469
128 Ga0466704_420260 3300042643 Bacteria 3123
129 Ga0466704_505834 3300042643 Bacteria 17390
130 2227512975 2225789004 Bacteria 3512
131 IMNBL1DRAFT_c0000921 3300000062 Bacteria 22740
132 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
133 JGI24702J35022_10037161 3300002462 Bacteria 2601
134 JGI24700J35501_10913919 3300002508 Bacteria 3805
135 Ga0068305_10002308 3300005083 Bacteria 45236
136 Ga0562378_1934 3300056814 Bacteria 19745
137 Ga0466715_232257 3300042616 Bacteria 9357
138 Ga0466715_462559 3300042616 Bacteria 14908
139 Ga0466715_535036 3300042616 Bacteria 4236
140 Ga0223688_1021784 3300021227 Bacteria 1382
141 Ga0466692_130735 3300042591 Bacteria 26218
142 Ga0466691_206597 3300042593 Bacteria 4586
143 Ga0466696_296201 3300042596 Bacteria 26567
144 Ga0123357_10361502 3300009784 Bacteria 1374
145 Ga0123355_10222639 3300009826 Bacteria 2710
146 Ga0123355_10362771 3300009826 Bacteria 1907
147 Ga0123355_10674429 3300009826 Bacteria 1197
148 Ga0123356_10055337 3300010049 Bacteria 3695
149 Ga0123356_10163707 3300010049 Bacteria 2225
150 Ga0123356_10177089 3300010049 Bacteria 2150
151 Ga0123356_10320696 3300010049 Bacteria 1662
152 Ga0123353_10007862 3300010167 Bacteria 14483
153 Ga0123353_10254878 3300010167 Bacteria 2714
154 Ga0123353_10314228 3300010167 Bacteria 2382
155 Ga0123353_10404891 3300010167 Unclassified 2029
156 Ga0123353_10426012 3300010167 Bacteria 1964
157 Ga0123353_10858693 3300010167 Unclassified 1243
158 Ga0123354_10106745 3300010882 Bacteria 3735
159 Ga0466706_107205 3300042599 Bacteria 176653
160 Ga0466706_113164 3300042599 Bacteria 25442
161 Ga0466706_237075 3300042599 Bacteria 3711
162 Ga0466713_014023 3300042602 Bacteria 32520
163 Ga0466714_118714 3300042603 Bacteria 2104
164 Ga0466722_045557 3300042609 Bacteria 252817
165 Ga0466722_177812 3300042609 Bacteria 2070
166 Ga0466722_189450 3300042609 Bacteria 5051
167 Ga0466735_050127 3300042624 Bacteria 1690
168 Ga0466709_418632 3300042648 Bacteria 47357
169 Ga0466724_20354 3300042649 Bacteria 4602
170 Ga0466725_414537 3300042654 Bacteria 1460
171 Ga0466727_054865 3300042655 Bacteria 148022
172 2227155796 2225789004 Bacteria 8466
173 2227324681 2225789004 Bacteria 1182
174 2227625483 2225789004 Bacteria 2158
175 JGI24700J35501_10927796 3300002508 Bacteria 7078
176 Ga0466715_188812 3300042616 Bacteria 9135
177 Ga0466715_576847 3300042616 Unclassified 2571
178 Ga0466728_218198 3300042620 Bacteria 17528
179 Ga0466728_452942 3300042620 Bacteria 39308
180 Ga0466729_179085 3300042621 Bacteria 60360
181 Ga0466696_484385 3300042596 Unclassified 1415
182 Ga0123355_10001065 3300009826 Bacteria 37847
183 Ga0123355_10001214 3300009826 Bacteria 35876
184 Ga0123355_10045502 3300009826 Bacteria 7139
185 Ga0123355_10090773 3300009826 Bacteria 4844
186 Ga0123355_10548888 3300009826 Bacteria 1398
187 Ga0123355_10590983 3300009826 Bacteria 1322
188 Ga0123355_10647816 3300009826 Bacteria 1234
189 Ga0123353_10085480 3300010167 Bacteria 5080
190 Ga0123353_10298821 3300010167 Bacteria 2459
191 Ga0123353_10335486 3300010167 Bacteria 2286
192 Ga0466713_006906 3300042602 Bacteria 112453
193 Ga0466714_067406 3300042603 Bacteria 1179
194 Ga0466734_069216 3300042623 Bacteria 3556
195 Ga0466730_095014 3300042625 Bacteria 15821
196 Ga0466708_135960 3300042652 Bacteria 21988
197 Ga0466725_069889 3300042654 Bacteria 3786
198 Ga0466725_224368 3300042654 Bacteria 9572
199 Ga0466725_306121 3300042654 Bacteria 2646
200 Ga0466725_357234 3300042654 Unclassified 4521
201 2227191891 2225789004 Bacteria 35154
202 2227507959 2225789004 Bacteria 65570
203 2227591299 2225789004 Bacteria 12952
204 JGI24702J35022_10013656 3300002462 Bacteria 4493
205 JGI24700J35501_10930794 3300002508 Bacteria 24253
206 Ga0063521_1000130 3300003973 Bacteria 58438
207 Ga0466705_059743 3300042612 Bacteria 8308
208 Ga0466715_309594 3300042616 Bacteria 109113
209 Ga0466726_481459 3300042619 Bacteria 3855
210 Ga0223687_100023 3300021217 Unclassified 1925
211 Ga0466690_182907 3300042590 Unclassified 1312
212 Ga0466690_253031 3300042590 Bacteria 3644
213 Ga0466690_281913 3300042590 Bacteria 36067
214 Ga0123355_10004905 3300009826 Bacteria 19468
215 Ga0123355_10024983 3300009826 Bacteria 9615
216 Ga0123355_10035834 3300009826 Bacteria 8066
217 Ga0123355_10334694 3300009826 Bacteria 2024
218 Ga0123355_10376686 3300009826 Bacteria 1854
219 Ga0123355_10727614 3300009826 Bacteria 1130
220 Ga0123356_10011608 3300010049 Bacteria 8584
221 Ga0123356_10079691 3300010049 Bacteria 3094
222 Ga0123356_10087799 3300010049 Bacteria 2955
223 Ga0123353_10085268 3300010167 Bacteria 5086
224 Ga0123353_10115883 3300010167 Bacteria 4312
225 Ga0123353_10267324 3300010167 Bacteria 2637
226 Ga0123353_10559822 3300010167 Bacteria 1646
227 Ga0466714_012747 3300042603 Bacteria 29171
228 Ga0466719_131463 3300042606 Bacteria 1690
229 Ga0466722_133312 3300042609 Bacteria 2502
230 Ga0466734_119789 3300042623 Bacteria 17928
231 Ga0466704_107009 3300042643 Bacteria 7254
232 Ga0466724_26922 3300042649 Bacteria 2522
233 Ga0466708_164450 3300042652 Bacteria 37163
234 Ga0466725_082702 3300042654 Bacteria 32093
235 Ga0466727_289823 3300042655 Bacteria 3236
236 2227013722 2225789003 Unclassified 5360
237 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
238 IMNBL1DRAFT_c0003266 3300000062 Bacteria 10568
239 AustNasuHG_c1025050 3300000089 Bacteria 1881
240 JGI24695J34938_10001623 3300002450 Bacteria 18771
241 Ga0466710_117340 3300042613 Bacteria 3301
242 Ga0466711_274923 3300042615 Bacteria 5249
243 Ga0466726_214965 3300042619 Bacteria 31160
244 Ga0466728_208642 3300042620 Bacteria 62806
245 Ga0466691_048976 3300042593 Bacteria 70909
246 Ga0123355_10263420 3300009826 Bacteria 2407
247 Ga0123355_10285081 3300009826 Bacteria 2274
248 Ga0123355_10599806 3300009826 Bacteria 1307
249 Ga0123356_10024887 3300010049 Bacteria 5628
250 Ga0123356_10182675 3300010049 Bacteria 2121
251 Ga0123353_10003404 3300010167 Bacteria 20101
252 Ga0123353_10272800 3300010167 Bacteria 2604
253 Ga0123354_10098977 3300010882 Bacteria 3961
254 Ga0466706_121576 3300042599 Bacteria 1755
255 Ga0466706_152943 3300042599 Bacteria 48130
256 Ga0466707_192483 3300042601 Bacteria 2932
257 Ga0466714_136654 3300042603 Bacteria 17666
258 Ga0466716_189379 3300042605 Bacteria 7789
259 Ga0466719_101917 3300042606 Bacteria 4223
260 Ga0466697_013057 3300042611 Bacteria 1730
261 Ga0466709_152308 3300042648 Bacteria 15669
262 Ga0466727_125041 3300042655 Bacteria 24880
263 Ga0466727_200110 3300042655 Bacteria 19231
264 2227524627 2225789004 Unclassified 16957
265 IMNBL1DRAFT_c0003830 3300000062 Bacteria 9372
266 IMNBL1DRAFT_c0021541 3300000062 Bacteria 2577
267 JGI24703J35330_11738853 3300002501 Bacteria 3239

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 26 225 0.99
PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain 244 309 0.96
PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain 56 175 0.95

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.