Protein Family IF00153
Metagenome
Isolate
160
Members
64
Samples
144
Scaffolds
177.07
Avg Length
Representative Sequence
- ID
- 2225789004|2227502988|2227987833
- Length
- 170 aa
- Sequence
- MNAQKLKKSIRNIPDFPVPGIQFKDVTTLFKDPECLRELIDGLYEMYKNEGITKVVGIESRGFVAGSLLAVRLNAGFIPIRKPGKLPAACFEEVYEKEYGVDAIQIHQDAVLSDDVVLATGGTMLAAVRLVKRFQPKKIYVNFIVELSDLNGRKLFDPEIQVDSIIKYDI
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.7%
Kalotermitidae
22.2%
Blattidae
14.3%
Unclassified
12.7%
Rhinotermitidae
6.3%
Termopsidae
6.3%
Passalidae
3.2%
Hodotermitidae
1.6%
Hydrophilidae
1.6%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 14 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 15 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 32 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 42 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 43 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 44 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 53 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 54 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 55 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 56 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 60 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 61 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 62 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 63 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10010847 | 3300010049 | Bacteria | 8910 |
| 2 | Ga0123353_10434542 | 3300010167 | Bacteria | 1939 |
| 3 | 2227477413 | 2225789004 | Unclassified | 22366 |
| 4 | IMNBL1DRAFT_c0008414 | 3300000062 | Bacteria | 5254 |
| 5 | Ga0068305_10006809 | 3300005083 | Bacteria | 17859 |
| 6 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 7 | Ga0466706_252336 | 3300042599 | Bacteria | 30022 |
| 8 | Ga0466700_119831 | 3300042600 | Bacteria | 20318 |
| 9 | Ga0466700_282668 | 3300042600 | Bacteria | 5041 |
| 10 | Ga0466713_124887 | 3300042602 | Bacteria | 13976 |
| 11 | Ga0466735_029307 | 3300042624 | Bacteria | 1121 |
| 12 | Ga0466735_194921 | 3300042624 | Bacteria | 1168 |
| 13 | Ga0466725_238693 | 3300042654 | Bacteria | 3784 |
| 14 | Ga0466656_310773 | 3300042550 | Bacteria | 1377 |
| 15 | Ga0466696_133442 | 3300042596 | Bacteria | 1906 |
| 16 | Ga0466705_056487 | 3300042612 | Bacteria | 11616 |
| 17 | IMNBL1DRAFT_c0002721 | 3300000062 | Bacteria | 12041 |
| 18 | JGI24699J35502_11134138 | 3300002509 | Bacteria | 36202 |
| 19 | Ga0068302_10101704 | 3300005071 | Bacteria | 4872 |
| 20 | Ga0123357_10001874 | 3300009784 | Bacteria | 22834 |
| 21 | Ga0466711_084970 | 3300042615 | Bacteria | 9199 |
| 22 | Ga0466723_051232 | 3300042618 | Bacteria | 14582 |
| 23 | Ga0466726_234425 | 3300042619 | Bacteria | 6071 |
| 24 | Ga0466729_092158 | 3300042621 | Bacteria | 2491 |
| 25 | Ga0466701_055658 | 3300042598 | Bacteria | 38151 |
| 26 | Ga0466706_210096 | 3300042599 | Bacteria | 35546 |
| 27 | Ga0466707_047169 | 3300042601 | Bacteria | 6490 |
| 28 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 29 | Ga0466716_450983 | 3300042605 | Bacteria | 2582 |
| 30 | Ga0466735_087827 | 3300042624 | Bacteria | 1143 |
| 31 | Ga0466735_099035 | 3300042624 | Bacteria | 1335 |
| 32 | Ga0466703_050326 | 3300042636 | Bacteria | 2282 |
| 33 | Ga0466690_018936 | 3300042590 | Bacteria | 8628 |
| 34 | Ga0466692_170474 | 3300042591 | Bacteria | 11860 |
| 35 | Ga0466693_250580 | 3300042592 | Bacteria | 1089 |
| 36 | Ga0123357_10037303 | 3300009784 | Bacteria | 6615 |
| 37 | Ga0123357_10428320 | 3300009784 | Bacteria | 1172 |
| 38 | Ga0123357_10000678 | 3300009784 | Bacteria | 34027 |
| 39 | Ga0466711_032287 | 3300042615 | Bacteria | 10941 |
| 40 | Ga0466715_055592 | 3300042616 | Bacteria | 3416 |
| 41 | Ga0466723_023375 | 3300042618 | Bacteria | 9981 |
| 42 | Ga0466706_057948 | 3300042599 | Bacteria | 28323 |
| 43 | Ga0466707_065158 | 3300042601 | Bacteria | 1640 |
| 44 | Ga0466713_000880 | 3300042602 | Bacteria | 20825 |
| 45 | Ga0466719_165573 | 3300042606 | Bacteria | 2253 |
| 46 | Ga0466698_047364 | 3300042610 | Bacteria | 1297 |
| 47 | Ga0466729_208225 | 3300042621 | Bacteria | 6570 |
| 48 | Ga0466704_307788 | 3300042643 | Bacteria | 15366 |
| 49 | Ga0466709_029361 | 3300042648 | Bacteria | 21526 |
| 50 | Ga0466709_233448 | 3300042648 | Bacteria | 27682 |
| 51 | Ga0123357_10282771 | 3300009784 | Bacteria | 1710 |
| 52 | Ga0123357_10438749 | 3300009784 | Bacteria | 1145 |
| 53 | Ga0123354_10186394 | 3300010882 | Bacteria | 2345 |
| 54 | Ga0123354_10195154 | 3300010882 | Unclassified | 2250 |
| 55 | Ga0123354_10809892 | 3300010882 | Bacteria | 629 |
| 56 | 2227642667 | 2225789004 | Bacteria | 2051 |
| 57 | IMNBL1DRAFT_c0000175 | 3300000062 | Bacteria | 57822 |
| 58 | Ga0068305_10008771 | 3300005083 | Bacteria | 11933 |
| 59 | Ga0123357_10001884 | 3300009784 | Bacteria | 22787 |
| 60 | Ga0466710_174404 | 3300042613 | Bacteria | 6957 |
| 61 | Ga0466710_392961 | 3300042613 | Bacteria | 3606 |
| 62 | Ga0466711_070021 | 3300042615 | Bacteria | 21814 |
| 63 | Ga0466715_093814 | 3300042616 | Bacteria | 11617 |
| 64 | Ga0466715_175518 | 3300042616 | Bacteria | 23921 |
| 65 | Ga0466715_366812 | 3300042616 | Bacteria | 14293 |
| 66 | Ga0466706_047715 | 3300042599 | Bacteria | 3182 |
| 67 | Ga0466713_118635 | 3300042602 | Bacteria | 4054 |
| 68 | Ga0466734_119882 | 3300042623 | Bacteria | 1248 |
| 69 | Ga0466704_577848 | 3300042643 | Bacteria | 5648 |
| 70 | Ga0466708_067288 | 3300042652 | Bacteria | 1768 |
| 71 | Ga0466727_268844 | 3300042655 | Bacteria | 4185 |
| 72 | Ga0466691_095154 | 3300042593 | Bacteria | 7390 |
| 73 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 74 | Ga0466697_080568 | 3300042611 | Bacteria | 3073 |
| 75 | Ga0123357_10108852 | 3300009784 | Bacteria | 3542 |
| 76 | Ga0123353_10348114 | 3300010167 | Bacteria | 2234 |
| 77 | Ga0123354_10000186 | 3300010882 | Bacteria | 52457 |
| 78 | Ga0123354_10078104 | 3300010882 | Bacteria | 4708 |
| 79 | Ga0123354_10135851 | 3300010882 | Bacteria | 3076 |
| 80 | JGI24702J35022_10209138 | 3300002462 | Bacteria | 1120 |
| 81 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 82 | Ga0123357_10001340 | 3300009784 | Bacteria | 26023 |
| 83 | Ga0466705_476893 | 3300042612 | Bacteria | 1864 |
| 84 | Ga0466715_597452 | 3300042616 | Bacteria | 11558 |
| 85 | Ga0466726_297614 | 3300042619 | Bacteria | 1256 |
| 86 | Ga0466707_136654 | 3300042601 | Bacteria | 15946 |
| 87 | Ga0466713_001029 | 3300042602 | Bacteria | 24080 |
| 88 | Ga0466703_045010 | 3300042636 | Bacteria | 4958 |
| 89 | Ga0466703_091103 | 3300042636 | Bacteria | 2765 |
| 90 | Ga0466703_158987 | 3300042636 | Bacteria | 11731 |
| 91 | Ga0466703_305891 | 3300042636 | Bacteria | 3380 |
| 92 | Ga0466704_031842 | 3300042643 | Bacteria | 1078 |
| 93 | Ga0466724_22017 | 3300042649 | Bacteria | 1062 |
| 94 | Ga0265387_1015732 | 3300024582 | Bacteria | 1078 |
| 95 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 96 | Ga0466691_070505 | 3300042593 | Bacteria | 29315 |
| 97 | Ga0123357_10012451 | 3300009784 | Bacteria | 10978 |
| 98 | Ga0123354_10039269 | 3300010882 | Bacteria | 7340 |
| 99 | 2227514102 | 2225789004 | Bacteria | 3487 |
| 100 | JGI24702J35022_10003166 | 3300002462 | Bacteria | 9954 |
| 101 | JGI24696J40584_12951105 | 3300002834 | Bacteria | 2210 |
| 102 | Ga0466728_029886 | 3300042620 | Bacteria | 13776 |
| 103 | Ga0466713_115762 | 3300042602 | Bacteria | 40052 |
| 104 | Ga0466713_135611 | 3300042602 | Bacteria | 8221 |
| 105 | Ga0466713_137960 | 3300042602 | Bacteria | 6491 |
| 106 | Ga0466734_147687 | 3300042623 | Bacteria | 2886 |
| 107 | Ga0466734_149994 | 3300042623 | Bacteria | 4128 |
| 108 | Ga0466735_031351 | 3300042624 | Bacteria | 11211 |
| 109 | Ga0466703_039792 | 3300042636 | Bacteria | 28795 |
| 110 | Ga0466703_104865 | 3300042636 | Bacteria | 1463 |
| 111 | Ga0466727_144932 | 3300042655 | Bacteria | 27909 |
| 112 | Ga0466727_342006 | 3300042655 | Bacteria | 6229 |
| 113 | Ga0466733_191039 | 3300042659 | Bacteria | 19413 |
| 114 | Ga0123357_10040028 | 3300009784 | Bacteria | 6377 |
| 115 | Ga0123357_10043666 | 3300009784 | Bacteria | 6090 |
| 116 | Ga0123353_10304462 | 3300010167 | Bacteria | 2430 |
| 117 | JGI24702J35022_10046647 | 3300002462 | Bacteria | 2307 |
| 118 | Ga0466726_076133 | 3300042619 | Bacteria | 50177 |
| 119 | Ga0466726_365104 | 3300042619 | Unclassified | 1764 |
| 120 | Ga0466728_209805 | 3300042620 | Bacteria | 2226 |
| 121 | Ga0466713_040603 | 3300042602 | Bacteria | 12338 |
| 122 | Ga0466713_113602 | 3300042602 | Bacteria | 3207 |
| 123 | Ga0466730_085903 | 3300042625 | Bacteria | 4984 |
| 124 | Ga0466703_165518 | 3300042636 | Bacteria | 3579 |
| 125 | Ga0466690_185737 | 3300042590 | Bacteria | 33974 |
| 126 | Ga0466692_073280 | 3300042591 | Bacteria | 28565 |
| 127 | Ga0466696_259378 | 3300042596 | Bacteria | 2492 |
| 128 | Ga0466697_271821 | 3300042611 | Bacteria | 3645 |
| 129 | Ga0123357_10018649 | 3300009784 | Bacteria | 9230 |
| 130 | Ga0123357_10094610 | 3300009784 | Bacteria | 3877 |
| 131 | Ga0123356_10083744 | 3300010049 | Bacteria | 3022 |
| 132 | Ga0123354_10000609 | 3300010882 | Bacteria | 37298 |
| 133 | 2227502988 | 2225789004 | Bacteria | 3750 |
| 134 | Ga0466715_264472 | 3300042616 | Bacteria | 19552 |
| 135 | Ga0466715_423803 | 3300042616 | Bacteria | 5939 |
| 136 | Ga0466707_072525 | 3300042601 | Bacteria | 13511 |
| 137 | Ga0466714_038141 | 3300042603 | Bacteria | 1487 |
| 138 | Ga0466722_061357 | 3300042609 | Bacteria | 4398 |
| 139 | Ga0466703_383513 | 3300042636 | Bacteria | 6484 |
| 140 | Ga0466709_214621 | 3300042648 | Bacteria | 11712 |
| 141 | Ga0466727_042186 | 3300042655 | Bacteria | 4400 |
| 142 | Ga0466692_165865 | 3300042591 | Bacteria | 23835 |
| 143 | Ga0466693_065087 | 3300042592 | Bacteria | 1255 |
| 144 | Ga0466696_057309 | 3300042596 | Bacteria | 8007 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 29 | 140 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.