Protein Family IF00136
Metagenome
Isolate
138
Members
54
Samples
129
Scaffolds
116.6
Avg Length
Representative Sequence
- ID
- 2225789004|2227172487|2227587294
- Length
- 117 aa
- Sequence
- MLIQVLKSKLHRVTVTGANLNYIGSIAIDEDLMDAANLIEGEKVQVVNNNNGERILETYVIKGDRGSGLICLNGAAARKFQPGDIILIISYALMDFEEAKTFKPTIVFPDTQTNKII
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.3%
Kalotermitidae
24.5%
Unclassified
13.2%
Blattidae
9.4%
Passalidae
7.5%
Rhinotermitidae
5.7%
Termopsidae
5.7%
Formicidae
1.9%
Armadillidiidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 10 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 14 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 24 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 43 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_164349 | 3300042599 | Bacteria | 1196 |
| 2 | Ga0466722_139431 | 3300042609 | Bacteria | 2461 |
| 3 | Ga0466723_322993 | 3300042618 | Bacteria | 9644 |
| 4 | Ga0466656_064295 | 3300042550 | Bacteria | 21933 |
| 5 | Ga0466690_173391 | 3300042590 | Bacteria | 6269 |
| 6 | Ga0466692_202144 | 3300042591 | Bacteria | 41419 |
| 7 | Ga0466727_023107 | 3300042655 | Bacteria | 2757 |
| 8 | Ga0123357_10202781 | 3300009784 | Bacteria | 2252 |
| 9 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 10 | Ga0466707_087386 | 3300042601 | Bacteria | 25499 |
| 11 | Ga0466713_029149 | 3300042602 | Bacteria | 36043 |
| 12 | Ga0466714_021915 | 3300042603 | Bacteria | 6382 |
| 13 | Ga0466716_038784 | 3300042605 | Bacteria | 7821 |
| 14 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 15 | 2227211345 | 2225789004 | Unclassified | 7620 |
| 16 | Ga0466711_017796 | 3300042615 | Bacteria | 31471 |
| 17 | Ga0466711_180713 | 3300042615 | Bacteria | 3021 |
| 18 | Ga0466711_271879 | 3300042615 | Bacteria | 2077 |
| 19 | Ga0466705_062995 | 3300042612 | Unclassified | 30508 |
| 20 | Ga0466705_183537 | 3300042612 | Unclassified | 1821 |
| 21 | Ga0466735_016863 | 3300042624 | Bacteria | 3434 |
| 22 | Ga0466735_071600 | 3300042624 | Bacteria | 2277 |
| 23 | Ga0466735_203732 | 3300042624 | Bacteria | 1468 |
| 24 | Ga0466703_168914 | 3300042636 | Bacteria | 2643 |
| 25 | Ga0466704_454557 | 3300042643 | Unclassified | 3500 |
| 26 | Ga0466708_016786 | 3300042652 | Bacteria | 8829 |
| 27 | Ga0466727_325173 | 3300042655 | Bacteria | 8998 |
| 28 | Ga0123357_10212782 | 3300009784 | Bacteria | 2166 |
| 29 | Ga0123353_13351655 | 3300010167 | Bacteria | 510 |
| 30 | Ga0466707_130395 | 3300042601 | Bacteria | 8519 |
| 31 | Ga0466707_186023 | 3300042601 | Bacteria | 2066 |
| 32 | Ga0466714_068450 | 3300042603 | Bacteria | 45601 |
| 33 | Ga0466722_013908 | 3300042609 | Bacteria | 2481 |
| 34 | Ga0068305_10362788 | 3300005083 | Unclassified | 3391 |
| 35 | Ga0466723_067878 | 3300042618 | Bacteria | 17474 |
| 36 | Ga0466691_074104 | 3300042593 | Unclassified | 1537 |
| 37 | Ga0466696_039553 | 3300042596 | Bacteria | 3953 |
| 38 | Ga0466705_365763 | 3300042612 | Bacteria | 1935 |
| 39 | Ga0466735_169326 | 3300042624 | Bacteria | 2981 |
| 40 | Ga0466735_227956 | 3300042624 | Bacteria | 3811 |
| 41 | Ga0466709_084692 | 3300042648 | Bacteria | 13480 |
| 42 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 43 | Ga0123357_10025345 | 3300009784 | Bacteria | 7999 |
| 44 | Ga0466733_001214 | 3300042659 | Bacteria | 8164 |
| 45 | Ga0466706_261458 | 3300042599 | Bacteria | 64291 |
| 46 | Ga0466707_145505 | 3300042601 | Bacteria | 11407 |
| 47 | Ga0466713_131209 | 3300042602 | Bacteria | 23837 |
| 48 | Ga0466713_156185 | 3300042602 | Bacteria | 14156 |
| 49 | 2227074703 | 2225789003 | Unclassified | 506 |
| 50 | 2227172487 | 2225789004 | Bacteria | 8167 |
| 51 | IMNBGM34_c000703 | 3300000036 | Bacteria | 8036 |
| 52 | IMNBL1DRAFT_c0002300 | 3300000062 | Bacteria | 13417 |
| 53 | IMNBL1DRAFT_c0002390 | 3300000062 | Bacteria | 13072 |
| 54 | IMNBL1DRAFT_c0006996 | 3300000062 | Bacteria | 6029 |
| 55 | IMNBL1DRAFT_c0073645 | 3300000062 | Unclassified | 977 |
| 56 | JGI24699J35502_11133498 | 3300002509 | Bacteria | 11170 |
| 57 | JGI24696J40584_12823066 | 3300002834 | Bacteria | 912 |
| 58 | Ga0072941_1488509 | 3300005201 | Bacteria | 932 |
| 59 | Ga0466726_264016 | 3300042619 | Bacteria | 1356 |
| 60 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 61 | Ga0466693_352542 | 3300042592 | Bacteria | 1065 |
| 62 | Ga0466696_123281 | 3300042596 | Bacteria | 1322 |
| 63 | Ga0466704_043997 | 3300042643 | Bacteria | 2576 |
| 64 | Ga0466709_128006 | 3300042648 | Bacteria | 1652 |
| 65 | Ga0466707_127369 | 3300042601 | Bacteria | 23245 |
| 66 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 67 | IMNBL1DRAFT_c0009285 | 3300000062 | Unclassified | 4874 |
| 68 | JGI24702J35022_10331331 | 3300002462 | Bacteria | 905 |
| 69 | Ga0466696_054420 | 3300042596 | Bacteria | 2709 |
| 70 | Ga0466729_271590 | 3300042621 | Bacteria | 21246 |
| 71 | Ga0466735_010932 | 3300042624 | Bacteria | 3258 |
| 72 | Ga0466735_047675 | 3300042624 | Bacteria | 5798 |
| 73 | Ga0466703_387508 | 3300042636 | Bacteria | 1702 |
| 74 | Ga0466727_128463 | 3300042655 | Bacteria | 4553 |
| 75 | Ga0123357_10007204 | 3300009784 | Bacteria | 13703 |
| 76 | Ga0123357_10010307 | 3300009784 | Bacteria | 11875 |
| 77 | Ga0123353_11749752 | 3300010167 | Bacteria | 775 |
| 78 | Ga0466700_249204 | 3300042600 | Bacteria | 41013 |
| 79 | Ga0466707_024006 | 3300042601 | Bacteria | 1868 |
| 80 | Ga0466707_292344 | 3300042601 | Bacteria | 5684 |
| 81 | Ga0466716_280844 | 3300042605 | Bacteria | 11537 |
| 82 | Ga0466722_254123 | 3300042609 | Bacteria | 1697 |
| 83 | 2227219701 | 2225789004 | Bacteria | 7501 |
| 84 | IMNBL1DRAFT_c0000568 | 3300000062 | Bacteria | 29871 |
| 85 | Ga0466726_320528 | 3300042619 | Bacteria | 1903 |
| 86 | Ga0466690_110780 | 3300042590 | Bacteria | 2557 |
| 87 | Ga0466692_194321 | 3300042591 | Bacteria | 22107 |
| 88 | Ga0466691_083264 | 3300042593 | Bacteria | 9351 |
| 89 | Ga0466695_207433 | 3300042595 | Bacteria | 2944 |
| 90 | Ga0466705_269427 | 3300042612 | Bacteria | 5294 |
| 91 | Ga0466735_025825 | 3300042624 | Bacteria | 3413 |
| 92 | Ga0466735_056189 | 3300042624 | Bacteria | 1236 |
| 93 | Ga0466730_051866 | 3300042625 | Bacteria | 3088 |
| 94 | Ga0466730_071563 | 3300042625 | Bacteria | 1304 |
| 95 | Ga0466703_067899 | 3300042636 | Bacteria | 3135 |
| 96 | Ga0466703_156544 | 3300042636 | Bacteria | 2503 |
| 97 | Ga0466703_245328 | 3300042636 | Bacteria | 15904 |
| 98 | Ga0466704_267944 | 3300042643 | Bacteria | 3119 |
| 99 | Ga0466704_341084 | 3300042643 | Unclassified | 4535 |
| 100 | Ga0466704_544626 | 3300042643 | Bacteria | 2130 |
| 101 | Ga0466727_239309 | 3300042655 | Bacteria | 2777 |
| 102 | Ga0123357_10012391 | 3300009784 | Bacteria | 10998 |
| 103 | Ga0466732_197063 | 3300042656 | Unclassified | 2318 |
| 104 | Ga0466733_041750 | 3300042659 | Bacteria | 4005 |
| 105 | Ga0466701_060584 | 3300042598 | Bacteria | 10254 |
| 106 | Ga0466707_194468 | 3300042601 | Bacteria | 43259 |
| 107 | Ga0466707_275002 | 3300042601 | Bacteria | 6933 |
| 108 | Ga0466719_500837 | 3300042606 | Bacteria | 4559 |
| 109 | Ga0466719_538826 | 3300042606 | Bacteria | 4418 |
| 110 | Ga0466705_456646 | 3300042612 | Bacteria | 1769 |
| 111 | Ga0466711_189251 | 3300042615 | Bacteria | 3435 |
| 112 | Ga0466715_274633 | 3300042616 | Bacteria | 14049 |
| 113 | Ga0466715_587699 | 3300042616 | Bacteria | 14428 |
| 114 | Ga0466726_372162 | 3300042619 | Bacteria | 13685 |
| 115 | Ga0160433_100043 | 3300012846 | Bacteria | 143692 |
| 116 | Ga0466656_251194 | 3300042550 | Bacteria | 1279 |
| 117 | Ga0466692_178028 | 3300042591 | Bacteria | 52823 |
| 118 | Ga0466692_184874 | 3300042591 | Bacteria | 3777 |
| 119 | Ga0466729_248794 | 3300042621 | Bacteria | 1908 |
| 120 | Ga0466735_155514 | 3300042624 | Bacteria | 2846 |
| 121 | Ga0123357_10021502 | 3300009784 | Bacteria | 8639 |
| 122 | Ga0466707_179774 | 3300042601 | Bacteria | 3561 |
| 123 | Ga0466713_015006 | 3300042602 | Bacteria | 3174 |
| 124 | Ga0466716_099427 | 3300042605 | Bacteria | 1009 |
| 125 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 126 | Ga0466694_312122 | 3300042594 | Bacteria | 2023 |
| 127 | Ga0466704_236228 | 3300042643 | Bacteria | 14834 |
| 128 | Ga0466709_371630 | 3300042648 | Bacteria | 7426 |
| 129 | Ga0466727_204683 | 3300042655 | Bacteria | 5111 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02261 | Asp_decarbox | Aspartate decarboxylase | 1 | 113 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.