


| Basic Information | |
|---|---|
| Family ID | F084812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MTKSSALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN |
| Number of Associated Samples | 48 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.28 % |
| % of genes near scaffold ends (potentially truncated) | 12.50 % |
| % of genes from short scaffolds (< 2000 bps) | 65.18 % |
| Associated GOLD sequencing projects | 37 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (76.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.036 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.56% β-sheet: 0.00% Coil/Unstructured: 58.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 8.93 |
| PF12686 | DUF3800 | 5.36 |
| PF00589 | Phage_integrase | 4.46 |
| PF00072 | Response_reg | 3.57 |
| PF02899 | Phage_int_SAM_1 | 3.57 |
| PF17191 | RecG_wedge | 1.79 |
| PF03781 | FGE-sulfatase | 1.79 |
| PF06296 | RelE | 1.79 |
| PF00211 | Guanylate_cyc | 1.79 |
| PF00378 | ECH_1 | 1.79 |
| PF00990 | GGDEF | 1.79 |
| PF02272 | DHHA1 | 0.89 |
| PF01926 | MMR_HSR1 | 0.89 |
| PF13614 | AAA_31 | 0.89 |
| PF14317 | YcxB | 0.89 |
| PF08984 | DUF1858 | 0.89 |
| PF13460 | NAD_binding_10 | 0.89 |
| PF00462 | Glutaredoxin | 0.89 |
| PF00483 | NTP_transferase | 0.89 |
| PF01047 | MarR | 0.89 |
| PF01875 | Memo | 0.89 |
| PF06250 | YhcG_C | 0.89 |
| PF09954 | DUF2188 | 0.89 |
| PF01841 | Transglut_core | 0.89 |
| PF01810 | LysE | 0.89 |
| PF13411 | MerR_1 | 0.89 |
| PF06114 | Peptidase_M78 | 0.89 |
| PF00398 | RrnaAD | 0.89 |
| PF13421 | Band_7_1 | 0.89 |
| PF01145 | Band_7 | 0.89 |
| PF13426 | PAS_9 | 0.89 |
| PF04055 | Radical_SAM | 0.89 |
| PF00155 | Aminotran_1_2 | 0.89 |
| PF01042 | Ribonuc_L-PSP | 0.89 |
| PF00578 | AhpC-TSA | 0.89 |
| PF00892 | EamA | 0.89 |
| PF00899 | ThiF | 0.89 |
| PF01656 | CbiA | 0.89 |
| PF06445 | GyrI-like | 0.89 |
| PF04773 | FecR | 0.89 |
| PF13581 | HATPase_c_2 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 3.57 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 3.57 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.79 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 1.79 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.89 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.89 |
| COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.96 % |
| Unclassified | root | N/A | 33.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078019|MiccSRB_F31IBB102F2D3V | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 544 | Open in IMG/M |
| 2044078019|MiccSRB_F31IBB102GLB8G | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 535 | Open in IMG/M |
| 2044078019|MiccSRB_F31IBB102HQPOD | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 538 | Open in IMG/M |
| 2070309003|MiccSRB_contig14173 | Not Available | 1354 | Open in IMG/M |
| 3300000470|M590M1_1000184 | All Organisms → cellular organisms → Bacteria | 122003 | Open in IMG/M |
| 3300000568|Draft_10046009 | All Organisms → cellular organisms → Bacteria | 23980 | Open in IMG/M |
| 3300000568|Draft_10068096 | All Organisms → cellular organisms → Bacteria | 68281 | Open in IMG/M |
| 3300000568|Draft_10173734 | All Organisms → cellular organisms → Bacteria | 8578 | Open in IMG/M |
| 3300002024|MIS_1128028 | Not Available | 1078 | Open in IMG/M |
| 3300002446|NAPDCCLC_10074781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium | 3263 | Open in IMG/M |
| 3300004063|Ga0055483_10104923 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005263|Ga0071346_1000661 | All Organisms → cellular organisms → Bacteria | 101173 | Open in IMG/M |
| 3300005403|Ga0074197_1016473 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 2036 | Open in IMG/M |
| 3300009666|Ga0116182_1344969 | Not Available | 600 | Open in IMG/M |
| 3300009669|Ga0116148_1163303 | Not Available | 1002 | Open in IMG/M |
| 3300009681|Ga0116174_10058194 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300009681|Ga0116174_10184037 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300009681|Ga0116174_10475778 | Not Available | 571 | Open in IMG/M |
| 3300009682|Ga0116172_10405300 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 641 | Open in IMG/M |
| 3300009685|Ga0116142_10505798 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009688|Ga0116176_10001079 | All Organisms → cellular organisms → Bacteria | 21638 | Open in IMG/M |
| 3300009690|Ga0116143_10428232 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300009692|Ga0116171_10000224 | All Organisms → cellular organisms → Bacteria | 59926 | Open in IMG/M |
| 3300009692|Ga0116171_10000829 | All Organisms → cellular organisms → Bacteria | 32062 | Open in IMG/M |
| 3300009692|Ga0116171_10003169 | All Organisms → cellular organisms → Bacteria | 15265 | Open in IMG/M |
| 3300009692|Ga0116171_10010107 | All Organisms → cellular organisms → Bacteria | 7674 | Open in IMG/M |
| 3300009692|Ga0116171_10011796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6952 | Open in IMG/M |
| 3300009692|Ga0116171_10031385 | All Organisms → cellular organisms → Bacteria | 3693 | Open in IMG/M |
| 3300009692|Ga0116171_10229682 | Not Available | 1037 | Open in IMG/M |
| 3300009692|Ga0116171_10408317 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 722 | Open in IMG/M |
| 3300009692|Ga0116171_10420524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300009692|Ga0116171_10477121 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 655 | Open in IMG/M |
| 3300009693|Ga0116141_10184813 | Not Available | 1163 | Open in IMG/M |
| 3300009693|Ga0116141_10491102 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 620 | Open in IMG/M |
| 3300009713|Ga0116163_1003381 | Not Available | 8987 | Open in IMG/M |
| 3300009713|Ga0116163_1017755 | All Organisms → cellular organisms → Bacteria | 3312 | Open in IMG/M |
| 3300009713|Ga0116163_1077025 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300009713|Ga0116163_1111339 | Not Available | 1035 | Open in IMG/M |
| 3300009713|Ga0116163_1173722 | Not Available | 771 | Open in IMG/M |
| 3300009713|Ga0116163_1174885 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 768 | Open in IMG/M |
| 3300009713|Ga0116163_1193486 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 718 | Open in IMG/M |
| 3300009713|Ga0116163_1281341 | Not Available | 560 | Open in IMG/M |
| 3300009772|Ga0116162_10038293 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300009772|Ga0116162_10118787 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218 | 1189 | Open in IMG/M |
| 3300009772|Ga0116162_10202391 | Not Available | 850 | Open in IMG/M |
| 3300009772|Ga0116162_10263625 | Not Available | 719 | Open in IMG/M |
| 3300009772|Ga0116162_10389632 | Not Available | 566 | Open in IMG/M |
| 3300009775|Ga0116164_10096495 | Not Available | 1419 | Open in IMG/M |
| 3300009775|Ga0116164_10309049 | Not Available | 668 | Open in IMG/M |
| 3300009776|Ga0116154_10110435 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 1237 | Open in IMG/M |
| 3300009776|Ga0116154_10387466 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 597 | Open in IMG/M |
| 3300009778|Ga0116151_10499968 | Not Available | 542 | Open in IMG/M |
| 3300009779|Ga0116152_10198592 | Not Available | 1036 | Open in IMG/M |
| 3300009780|Ga0116156_10241476 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 939 | Open in IMG/M |
| 3300009782|Ga0116157_10175892 | Not Available | 1198 | Open in IMG/M |
| 3300009782|Ga0116157_10677989 | Not Available | 516 | Open in IMG/M |
| 3300010346|Ga0116239_10061103 | All Organisms → cellular organisms → Bacteria | 3420 | Open in IMG/M |
| 3300010346|Ga0116239_10407819 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 921 | Open in IMG/M |
| 3300010346|Ga0116239_10408530 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 920 | Open in IMG/M |
| 3300010346|Ga0116239_10877907 | Not Available | 558 | Open in IMG/M |
| 3300010349|Ga0116240_10121091 | Not Available | 2010 | Open in IMG/M |
| 3300010350|Ga0116244_10022369 | All Organisms → cellular organisms → Bacteria | 5878 | Open in IMG/M |
| 3300010350|Ga0116244_10050631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3434 | Open in IMG/M |
| 3300010350|Ga0116244_10069992 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300010350|Ga0116244_10114108 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300010350|Ga0116244_10470017 | Not Available | 832 | Open in IMG/M |
| 3300010350|Ga0116244_10671627 | Not Available | 672 | Open in IMG/M |
| 3300010350|Ga0116244_10836181 | Not Available | 591 | Open in IMG/M |
| 3300010351|Ga0116248_10111900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium | 2418 | Open in IMG/M |
| 3300010351|Ga0116248_10306356 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300010351|Ga0116248_10791932 | Not Available | 661 | Open in IMG/M |
| 3300010352|Ga0116247_10037606 | All Organisms → cellular organisms → Bacteria | 4776 | Open in IMG/M |
| 3300010352|Ga0116247_10322374 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300010352|Ga0116247_10522174 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 912 | Open in IMG/M |
| 3300010352|Ga0116247_10574310 | Not Available | 860 | Open in IMG/M |
| 3300010352|Ga0116247_10692332 | Not Available | 765 | Open in IMG/M |
| 3300010356|Ga0116237_10504053 | Not Available | 1059 | Open in IMG/M |
| 3300010356|Ga0116237_11082853 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 670 | Open in IMG/M |
| 3300010429|Ga0116241_10161827 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300010429|Ga0116241_10572324 | Not Available | 879 | Open in IMG/M |
| 3300014833|Ga0119870_1036983 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 1666 | Open in IMG/M |
| 3300015214|Ga0172382_10462205 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018030|Ga0187869_10365678 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 690 | Open in IMG/M |
| 3300019213|Ga0179950_1035822 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 1799 | Open in IMG/M |
| 3300019225|Ga0179949_1044612 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300020048|Ga0207193_1023794 | All Organisms → cellular organisms → Bacteria | 7477 | Open in IMG/M |
| 3300020048|Ga0207193_1098859 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300020048|Ga0207193_1242037 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300020048|Ga0207193_1366516 | Not Available | 976 | Open in IMG/M |
| 3300020048|Ga0207193_1390039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 934 | Open in IMG/M |
| 3300020048|Ga0207193_1541926 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 772 | Open in IMG/M |
| 3300020048|Ga0207193_1866258 | Not Available | 519 | Open in IMG/M |
| 3300025611|Ga0209408_1004800 | All Organisms → cellular organisms → Bacteria | 6479 | Open in IMG/M |
| 3300025611|Ga0209408_1006341 | All Organisms → cellular organisms → Bacteria | 5267 | Open in IMG/M |
| 3300025611|Ga0209408_1006842 | All Organisms → cellular organisms → Bacteria | 4965 | Open in IMG/M |
| 3300025611|Ga0209408_1097329 | Not Available | 779 | Open in IMG/M |
| 3300025611|Ga0209408_1155805 | Not Available | 560 | Open in IMG/M |
| 3300025702|Ga0209203_1110023 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5 | 906 | Open in IMG/M |
| 3300025847|Ga0209607_1127375 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 1046 | Open in IMG/M |
| 3300025856|Ga0209604_1344785 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025858|Ga0209099_1000945 | All Organisms → cellular organisms → Bacteria | 32065 | Open in IMG/M |
| 3300025858|Ga0209099_1004763 | All Organisms → cellular organisms → Bacteria | 10132 | Open in IMG/M |
| 3300025858|Ga0209099_1005169 | All Organisms → cellular organisms → Bacteria | 9550 | Open in IMG/M |
| 3300025858|Ga0209099_1006876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 7825 | Open in IMG/M |
| 3300025858|Ga0209099_1007605 | All Organisms → cellular organisms → Bacteria | 7313 | Open in IMG/M |
| 3300025858|Ga0209099_1146984 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300025858|Ga0209099_1250762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300025861|Ga0209605_1358068 | Not Available | 509 | Open in IMG/M |
| 3300027373|Ga0209016_1098900 | Not Available | 603 | Open in IMG/M |
| 3300028603|Ga0265293_10055679 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
| 3300033169|Ga0334887_1008067 | All Organisms → cellular organisms → Bacteria | 7610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 76.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 6.25% |
| Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 3.57% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 2.68% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.79% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 1.79% |
| Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.89% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078019 | Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383 | Environmental | Open in IMG/M |
| 2070309003 | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12383, Newbler assembly | Environmental | Open in IMG/M |
| 3300000470 | Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Photosynthetic Consortia grown using light of 590nm sample 1 | Environmental | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002024 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k | Environmental | Open in IMG/M |
| 3300002446 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300005263 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3 | Environmental | Open in IMG/M |
| 3300005403 | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 reassembly with SPADES | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009775 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300014833 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300019213 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019225 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025702 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027373 | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 (SPAdes) | Engineered | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300033169 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_18_07-R1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MiccSRB12980600 | 2044078019 | Concrete Drainage Pipe Biofilm | MSKQSNLSLDNWSKGLLISLITKAISSDKDMTPDDIEKLKEIKKQLQEI |
| MiccSRB9043810 | 2044078019 | Concrete Drainage Pipe Biofilm | MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKE |
| MiccSRB2380330 | 2044078019 | Concrete Drainage Pipe Biofilm | MAKESSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKEIKKQLQEIN |
| MiccSRB_01066930 | 2070309003 | Concrete Drainage Pipe Biofilm | MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEIQPPDKK |
| M590M1_100018437 | 3300000470 | Salt Marsh | MSNSIKLDNYGKGLLVNIISKAISNDRDLTEDDVEKLKEIKKQLQEG* |
| Draft_1004600911 | 3300000568 | Hydrocarbon Resource Environments | MIKNEAFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Draft_1006809620 | 3300000568 | Hydrocarbon Resource Environments | MTKSSALKLDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQER* |
| Draft_101737343 | 3300000568 | Hydrocarbon Resource Environments | MKKSALKLDNYGKGLLVSIISKSISNDKDLTPDDIEKLKEIKKQLQET* |
| MIS_11280283 | 3300002024 | Sinkhole Freshwater | MAKTSSMKLDDWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI* |
| NAPDCCLC_100747813 | 3300002446 | Hydrocarbon Resource Environments | MTKNESFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0055483_101049232 | 3300004063 | Natural And Restored Wetlands | MPKLTNLKLDDWGKGLLVNLISKAISNDKDLTSDDIDKLKIIKKQLQESIT* |
| Ga0071346_1000661103 | 3300005263 | Anaerobic Enrichment Culture | MKKSSLNLDNHGKGLLIGLISKAINDDKNLASDDIEKLKEIKKQLQGE* |
| Ga0074197_10164732 | 3300005403 | Bioremediated Contaminated Groundwater | MVKESTLKLDNWSKGLLISLISKAVSSDKDITQDDIEKLKEIKKQLQEI* |
| Ga0116182_13449691 | 3300009666 | Anaerobic Digestor Sludge | MTKNEAFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116148_11633031 | 3300009669 | Anaerobic Digestor Sludge | MSKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116174_100581941 | 3300009681 | Anaerobic Digestor Sludge | MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQ |
| Ga0116174_101840372 | 3300009681 | Anaerobic Digestor Sludge | MAKSNALKLDNYGKGLLVNLISKAISNDRDLTDYDIEKLKEIKKQLQEN* |
| Ga0116174_104757781 | 3300009681 | Anaerobic Digestor Sludge | MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116172_104053002 | 3300009682 | Anaerobic Digestor Sludge | MAKESSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN* |
| Ga0116142_105057982 | 3300009685 | Anaerobic Digestor Sludge | MDYKMPKLTNLKLDDWGKGLLVNIISKAISNDKDLTNDDIEKLKLIKKQLQESIS* |
| Ga0116176_1000107920 | 3300009688 | Anaerobic Digestor Sludge | MTKSNSIKLDNYGKGLLVGLISKAISNDRDLTDDDIDKLKEIKKQLQEN* |
| Ga0116143_104282322 | 3300009690 | Anaerobic Digestor Sludge | MTKSSALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116171_1000022438 | 3300009692 | Anaerobic Digestor Sludge | MSKNSIINLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY* |
| Ga0116171_100008293 | 3300009692 | Anaerobic Digestor Sludge | MAKQSILKLDNWSKGLLISIISKAISSDKDITHDDIEKLKEIKKQLQETQPPDKK* |
| Ga0116171_1000316920 | 3300009692 | Anaerobic Digestor Sludge | MAKQSDLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI* |
| Ga0116171_100101074 | 3300009692 | Anaerobic Digestor Sludge | MKKSSLILDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE* |
| Ga0116171_100117962 | 3300009692 | Anaerobic Digestor Sludge | MKKSSLNLDNHGKGLLIGLISKAINDDKTLASDDIEKLKEIKKQLQEE* |
| Ga0116171_100313852 | 3300009692 | Anaerobic Digestor Sludge | MAKGSSLKLDNWSKGLLINLISKAIGSNKDITPDDIEKLKEIKKQLQEI* |
| Ga0116171_102296822 | 3300009692 | Anaerobic Digestor Sludge | MAKESSLKFDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN* |
| Ga0116171_104083171 | 3300009692 | Anaerobic Digestor Sludge | MNKNNIRIDDWGKGHLVTIINKAIGNDKDLTRDDIEKLKEIKKLLQGI* |
| Ga0116171_104205242 | 3300009692 | Anaerobic Digestor Sludge | MKKSRLNLDNHGKGLLIQLISKAINNDKSLTSDDVEKLKEIKKQLQEE* |
| Ga0116171_104771212 | 3300009692 | Anaerobic Digestor Sludge | MSKQSTLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQETQPQDKK* |
| Ga0116141_101848132 | 3300009693 | Anaerobic Digestor Sludge | MPKLTNLKLDDWGKGLLVNIISKAISNDKDMTNDDIEKLKLIKKQLQESIS* |
| Ga0116141_104911021 | 3300009693 | Anaerobic Digestor Sludge | MTKQSTLKLDDWSKGLLINLISKAIRNDKDITQDDVEKLKEIKKQLQEI* |
| Ga0116163_10033818 | 3300009713 | Anaerobic Digestor Sludge | MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQEA* |
| Ga0116163_10177555 | 3300009713 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKDIKKQLQEN* |
| Ga0116163_10770252 | 3300009713 | Anaerobic Digestor Sludge | MKKSVLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES* |
| Ga0116163_11113391 | 3300009713 | Anaerobic Digestor Sludge | MIKKSSNSLDNWGKGLLINLISKSISNDKNLTQDDIEKLKKIKKELQEI* |
| Ga0116163_11737222 | 3300009713 | Anaerobic Digestor Sludge | MINKSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI* |
| Ga0116163_11748851 | 3300009713 | Anaerobic Digestor Sludge | MAKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116163_11934861 | 3300009713 | Anaerobic Digestor Sludge | MTKSNSIKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116163_12813412 | 3300009713 | Anaerobic Digestor Sludge | FKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116162_100382932 | 3300009772 | Anaerobic Digestor Sludge | MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQET* |
| Ga0116162_101187871 | 3300009772 | Anaerobic Digestor Sludge | MRHKKMKKNNSPITLDNYGKGLLIGIISRAISEDKSLAPDDIEKLKEIKKELQDI* |
| Ga0116162_102023912 | 3300009772 | Anaerobic Digestor Sludge | MKKTDLKLDNYGRGLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA* |
| Ga0116162_102636252 | 3300009772 | Anaerobic Digestor Sludge | MAKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116162_103896321 | 3300009772 | Anaerobic Digestor Sludge | KSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI* |
| Ga0116164_100176401 | 3300009775 | Anaerobic Digestor Sludge | NYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES* |
| Ga0116164_100964951 | 3300009775 | Anaerobic Digestor Sludge | MIKKSSISLDNWGKGLLINLISKSISNDKNLTQDDIEKLKDIKKQLQEI* |
| Ga0116164_103090492 | 3300009775 | Anaerobic Digestor Sludge | MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDDLNKLKEIKKQLQDA |
| Ga0116154_101104354 | 3300009776 | Anaerobic Digestor Sludge | MAKESSLKLDDWSKGLLISIISKAMSSDKDITQDDIEKLKEIKKQLQEI* |
| Ga0116154_103874662 | 3300009776 | Anaerobic Digestor Sludge | MTKMSNLKLDNWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI* |
| Ga0116151_104999682 | 3300009778 | Anaerobic Digestor Sludge | MAKNEAFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116152_101985921 | 3300009779 | Anaerobic Digestor Sludge | LKKKTDLKLDNYGRGLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA* |
| Ga0116156_102414763 | 3300009780 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116157_101758923 | 3300009782 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKESKKQLQEN* |
| Ga0116157_106779891 | 3300009782 | Anaerobic Digestor Sludge | MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDIEKLKEIKKQLQEN* |
| Ga0116239_100611031 | 3300010346 | Anaerobic Digestor Sludge | MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES* |
| Ga0116239_104078191 | 3300010346 | Anaerobic Digestor Sludge | MTKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQE |
| Ga0116239_104085304 | 3300010346 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116239_108779071 | 3300010346 | Anaerobic Digestor Sludge | MIKKSGISLDNWVKGLLISLISKSISNDKNLTQDDIEKLKDIKKQLQEI* |
| Ga0116240_101210911 | 3300010349 | Anaerobic Digestor Sludge | MKKTNLKLDNYGRRLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA* |
| Ga0116244_100223698 | 3300010350 | Anaerobic Digestor Sludge | MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDD |
| Ga0116244_100506316 | 3300010350 | Anaerobic Digestor Sludge | MNKSNTYKLNNYGKGLLVNIISKAISNDRDLTDDDIEKLKEIKKLLQEN* |
| Ga0116244_100699924 | 3300010350 | Anaerobic Digestor Sludge | MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDDLNKLKEIKKQLQDAAVKITGSI* |
| Ga0116244_101141082 | 3300010350 | Anaerobic Digestor Sludge | MAKSNALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116244_104700171 | 3300010350 | Anaerobic Digestor Sludge | MTKSNAIKLDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN* |
| Ga0116244_106716272 | 3300010350 | Anaerobic Digestor Sludge | MKKSNSITLDNYSRGLLVGIISRAISEDKSLTPDDIEKLKEIKKELQGS* |
| Ga0116244_108361811 | 3300010350 | Anaerobic Digestor Sludge | MKSKSTKLELDNYGAGLLIGIISRALSSDKSLTEYDIEKLREIKTQLQESYN* |
| Ga0116248_101119003 | 3300010351 | Anaerobic Digestor Sludge | MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIDKLKEIKKQLQEN* |
| Ga0116248_103063561 | 3300010351 | Anaerobic Digestor Sludge | LSPYFFKAENSMSKKSSLSLDNWGKGLLVNIISKAISNDKDLTPDDIEKLKEIKKQLQEN |
| Ga0116248_107919322 | 3300010351 | Anaerobic Digestor Sludge | MINKSSIKLDNWGKGLLLNLISKSISNDKNLTQDDIEKLKEIKKQLQEI* |
| Ga0116247_100376064 | 3300010352 | Anaerobic Digestor Sludge | MKKRSLKLDNHGKGLLIGLISKAINDDKSLAPDDVDKLKEIKKQLQEE* |
| Ga0116247_103223742 | 3300010352 | Anaerobic Digestor Sludge | MKKSTLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES* |
| Ga0116247_105221741 | 3300010352 | Anaerobic Digestor Sludge | MAKQSNLKLDNWSKGLLINIISKAISNDKDMTPDDIEKLKE |
| Ga0116247_105743101 | 3300010352 | Anaerobic Digestor Sludge | MKKNSFNLDNYGKGLLIGIISKAISEDKNLTPDDIEKLKAIKKQLQEN* |
| Ga0116247_106923321 | 3300010352 | Anaerobic Digestor Sludge | MAKVNSLKLDNWSKGLLINLISKAISSDKDITQDDIEKLKEIKKQLQDM* |
| Ga0116237_105040535 | 3300010356 | Anaerobic Digestor Sludge | MKKSSLNLDNYGKGLLIGIISKAISEDKSLTADDIEKLKEIKKQLQES* |
| Ga0116237_110828532 | 3300010356 | Anaerobic Digestor Sludge | MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEI |
| Ga0116241_101618272 | 3300010429 | Anaerobic Digestor Sludge | MAKESSSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN* |
| Ga0116241_105723242 | 3300010429 | Anaerobic Digestor Sludge | MKKSSLTLDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE* |
| Ga0119870_10369835 | 3300014833 | Activated Sludge | MAKMSSLKLDNWSKGLLISIISKAISGDREMTPDDIEKLKEIKKLL |
| Ga0172382_104622051 | 3300015214 | Landfill Leachate | MKKNTSITLDNYEKGLLIGIISRAISDDKNLASDDIEKLKELKKELQEI* |
| Ga0187869_103656781 | 3300018030 | Peatland | MKTNNKLELDNWSKGLLINLISKAISNDKDLTQDDIEKLRAIKKQLQEN |
| Ga0179950_10358224 | 3300019213 | Anaerobic Digestor Sludge | DNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY |
| Ga0179949_10446121 | 3300019225 | Anaerobic Digestor Sludge | MSKNSIVNLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY |
| Ga0207193_10237948 | 3300020048 | Freshwater Lake Sediment | MKKSSLNLDNHGKGLLIGLITKAINDDKSLAADDIEKLKDIKKLLQEE |
| Ga0207193_10988593 | 3300020048 | Freshwater Lake Sediment | MAKESNLKLDNWSKGLLIGIISKAISSDRDMTPDDIEKLKEIKKQLQEI |
| Ga0207193_12420371 | 3300020048 | Freshwater Lake Sediment | MKKNSLTLDNHGKGLLIGLISKAINDDKTLAADDIEKLKEIKKQLQGD |
| Ga0207193_13665163 | 3300020048 | Freshwater Lake Sediment | MAKESSLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI |
| Ga0207193_13900391 | 3300020048 | Freshwater Lake Sediment | MAKESSLKLDNWSKGLLISLISKAISSDKDITQDDIE |
| Ga0207193_15419262 | 3300020048 | Freshwater Lake Sediment | MTKMSNLKLDNWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI |
| Ga0207193_18662581 | 3300020048 | Freshwater Lake Sediment | MAKMSSLNLDNWSKGLLISLISKAISNDKDITQDDIEKLKEIKKQLQEI |
| Ga0209408_10048002 | 3300025611 | Anaerobic Digestor Sludge | MKKSVLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES |
| Ga0209408_10063417 | 3300025611 | Anaerobic Digestor Sludge | MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQEA |
| Ga0209408_10068425 | 3300025611 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKDIKKQLQEN |
| Ga0209408_10973293 | 3300025611 | Anaerobic Digestor Sludge | MINKSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI |
| Ga0209408_11558051 | 3300025611 | Anaerobic Digestor Sludge | FKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN |
| Ga0209203_11100231 | 3300025702 | Anaerobic Digestor Sludge | KSSISLDNWGKGLLINLISKSISNDKNLTQDDIEKLKDIKKQLQEI |
| Ga0209607_11273751 | 3300025847 | Anaerobic Digestor Sludge | MTKSNSIKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN |
| Ga0209604_13447852 | 3300025856 | Anaerobic Digestor Sludge | MPKLTNLKLDDWGKGLLVNIISKAISNDKDMTNDDIEKLKLIKKQLQESIS |
| Ga0209099_10009458 | 3300025858 | Anaerobic Digestor Sludge | MAKQSILKLDNWSKGLLISIISKAISSDKDITHDDIEKLKEIKKQLQETQPPDKK |
| Ga0209099_100476316 | 3300025858 | Anaerobic Digestor Sludge | MAKQSDLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI |
| Ga0209099_10051699 | 3300025858 | Anaerobic Digestor Sludge | MKKSSLILDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE |
| Ga0209099_10068762 | 3300025858 | Anaerobic Digestor Sludge | MKKSSLNLDNHGKGLLIGLISKAINDDKTLASDDIEKLKEIKKQLQEE |
| Ga0209099_10076056 | 3300025858 | Anaerobic Digestor Sludge | MSKNSIINLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY |
| Ga0209099_11469842 | 3300025858 | Anaerobic Digestor Sludge | MSKQSTLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN |
| Ga0209099_12507621 | 3300025858 | Anaerobic Digestor Sludge | MKKSRLNLDNHGKGLLIQLISKAINNDKSLTSDDVEKLKEIKKQLQEE |
| Ga0209605_13580682 | 3300025861 | Anaerobic Digestor Sludge | MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN |
| Ga0209016_10989002 | 3300027373 | Bioremediated Contaminated Groundwater | MKKSTLNLDNHAKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE |
| Ga0265293_100556792 | 3300028603 | Landfill Leachate | MKKNTSITLDNYEKGLLIGIISRAISDDKNLASDDIEKLKELKKELQEI |
| Ga0334887_10080676 | 3300033169 | Sludge | MKKKNTEISLDNHGKGLLIGIISRALSEDKSLAPDDIDKLKEIKKQLQEV |
| ⦗Top⦘ |