NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000470

3300000470: Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Photosynthetic Consortia grown using light of 590nm sample 1



Overview

Basic Information
IMG/M Taxon OID3300000470 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0075607 | Gp0055224 | Ga0011585
Sample NameMicrobial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Photosynthetic Consortia grown using light of 590nm sample 1
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size55293564
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSalt Marsh Microbial Communities From Little Sippewissett, Woods Hole, Ma That Are Anoxygenic And Photosynthetic
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Microbial Communities From Little Sippewissett, Woods Hole, Ma That Are Anoxygenic And Photosynthetic

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationLittle Sippewissett Salt Marsh, Woods Hole, MA
CoordinatesLat. (o)41.5758508Long. (o)-70.635807Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084812Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
M590M1_1000184All Organisms → cellular organisms → Bacteria122003Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
M590M1_1000184M590M1_100018437F084812MSNSIKLDNYGKGLLVNIISKAISNDRDLTEDDVEKLKEIKKQLQEG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.