


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005403 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095509 | Gp0056883 | Ga0074197 |
| Sample Name | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 reassembly with SPADES |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 241269698 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 8 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 3 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Spirochaetes | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.992 | Long. (o) | -106.0797 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067350 | Metagenome / Metatranscriptome | 125 | Y |
| F079376 | Metagenome / Metatranscriptome | 116 | Y |
| F084812 | Metagenome / Metatranscriptome | 112 | Y |
| F086799 | Metagenome / Metatranscriptome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074197_1009510 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| Ga0074197_1011103 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
| Ga0074197_1012101 | Not Available | 2774 | Open in IMG/M |
| Ga0074197_1013723 | Not Available | 2439 | Open in IMG/M |
| Ga0074197_1015759 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| Ga0074197_1016473 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 2036 | Open in IMG/M |
| Ga0074197_1027233 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1264 | Open in IMG/M |
| Ga0074197_1043931 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 | 806 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074197_1009510 | Ga0074197_10095102 | F079376 | MLPGVGDHGMSDIVIIREPGRPCVSFGVMRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV* |
| Ga0074197_1011103 | Ga0074197_10111034 | F067350 | MKDENMLKKKVFDDSAVAAALRRGHRQELYFEQIAVFRH* |
| Ga0074197_1012101 | Ga0074197_10121013 | F067350 | MKGENMLKKKVFGDAAVVAALRRGHRQELYFEQIAVFRHQFMNYSG* |
| Ga0074197_1013723 | Ga0074197_10137233 | F067350 | MKDENMLKKKVFGDAAVVAALRRGHRQVLYFEQIAVFRHQFMNYSG* |
| Ga0074197_1015759 | Ga0074197_10157592 | F067350 | MKDENMLKKKVFGDAAGVAALRRGHRQELYFEQIAVFRH* |
| Ga0074197_1016473 | Ga0074197_10164732 | F084812 | MVKESTLKLDNWSKGLLISLISKAVSSDKDITQDDIEKLKEIKKQLQEI* |
| Ga0074197_1027233 | Ga0074197_10272332 | F067350 | MKDEYMLKKKVFEDATVVAALRRGHRQELYFEQIAVFRH* |
| Ga0074197_1043931 | Ga0074197_10439312 | F086799 | MKAKKVTYSRLISKGNYENAKIEIELEVEAGEKAVDVFAAAKNWVEKRITIEKLSDYMVEKAKKVMEDKRNHTLAQIEEAEEILLKAKEKDEELPF* |
| ⦗Top⦘ |