NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005403

3300005403: Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 reassembly with SPADES



Overview

Basic Information
IMG/M Taxon OID3300005403 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095509 | Gp0056883 | Ga0074197
Sample NameBioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 reassembly with SPADES
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size241269698
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
Not Available2
All Organisms → cellular organisms → Bacteria → Spirochaetes1
All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA3951

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico
TypeEngineered
TaxonomyEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationEspanola, New Mexico, United States
CoordinatesLat. (o)35.992Long. (o)-106.0797Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067350Metagenome / Metatranscriptome125Y
F079376Metagenome / Metatranscriptome116Y
F084812Metagenome / Metatranscriptome112Y
F086799Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074197_1009510All Organisms → cellular organisms → Bacteria3540Open in IMG/M
Ga0074197_1011103All Organisms → cellular organisms → Bacteria3021Open in IMG/M
Ga0074197_1012101Not Available2774Open in IMG/M
Ga0074197_1013723Not Available2439Open in IMG/M
Ga0074197_1015759All Organisms → cellular organisms → Bacteria2133Open in IMG/M
Ga0074197_1016473All Organisms → cellular organisms → Bacteria → Spirochaetes2036Open in IMG/M
Ga0074197_1027233All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium1264Open in IMG/M
Ga0074197_1043931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395806Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074197_1009510Ga0074197_10095102F079376MLPGVGDHGMSDIVIIREPGRPCVSFGVMRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV*
Ga0074197_1011103Ga0074197_10111034F067350MKDENMLKKKVFDDSAVAAALRRGHRQELYFEQIAVFRH*
Ga0074197_1012101Ga0074197_10121013F067350MKGENMLKKKVFGDAAVVAALRRGHRQELYFEQIAVFRHQFMNYSG*
Ga0074197_1013723Ga0074197_10137233F067350MKDENMLKKKVFGDAAVVAALRRGHRQVLYFEQIAVFRHQFMNYSG*
Ga0074197_1015759Ga0074197_10157592F067350MKDENMLKKKVFGDAAGVAALRRGHRQELYFEQIAVFRH*
Ga0074197_1016473Ga0074197_10164732F084812MVKESTLKLDNWSKGLLISLISKAVSSDKDITQDDIEKLKEIKKQLQEI*
Ga0074197_1027233Ga0074197_10272332F067350MKDEYMLKKKVFEDATVVAALRRGHRQELYFEQIAVFRH*
Ga0074197_1043931Ga0074197_10439312F086799MKAKKVTYSRLISKGNYENAKIEIELEVEAGEKAVDVFAAAKNWVEKRITIEKLSDYMVEKAKKVMEDKRNHTLAQIEEAEEILLKAKEKDEELPF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.