NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023595

Metagenome / Metatranscriptome Family F023595

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023595
Family Type Metagenome / Metatranscriptome
Number of Sequences 209
Average Sequence Length 45 residues
Representative Sequence MVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK
Number of Associated Samples 89
Number of Associated Scaffolds 209

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.22 %
% of genes near scaffold ends (potentially truncated) 59.81 %
% of genes from short scaffolds (< 2000 bps) 80.38 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment
(20.574 % of family members)
Environment Ontology (ENVO) Unclassified
(22.967 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(26.316 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 209 Family Scaffolds
PF09723Zn-ribbon_8 1.44
PF06415iPGM_N 1.44
PF10609ParA 1.44
PF00682HMGL-like 0.96
PF00155Aminotran_1_2 0.96
PF01895PhoU 0.96
PF08359TetR_C_4 0.96
PF01654Cyt_bd_oxida_I 0.96
PF01592NifU_N 0.96
PF00324AA_permease 0.96
PF00881Nitroreductase 0.96
PF02416TatA_B_E 0.96
PF02653BPD_transp_2 0.96
PF00072Response_reg 0.96
PF02589LUD_dom 0.96
PF01676Metalloenzyme 0.96
PF07085DRTGG 0.96
PF01964ThiC_Rad_SAM 0.48
PF01155HypA 0.48
PF00501AMP-binding 0.48
PF13561adh_short_C2 0.48
PF01343Peptidase_S49 0.48
PF00149Metallophos 0.48
PF14691Fer4_20 0.48
PF00108Thiolase_N 0.48
PF04267SoxD 0.48
PF03480DctP 0.48
PF04060FeS 0.48
PF00137ATP-synt_C 0.48
PF00118Cpn60_TCP1 0.48
PF02646RmuC 0.48
PF08360TetR_C_5 0.48
PF12327FtsZ_C 0.48
PF08668HDOD 0.48
PF00005ABC_tran 0.48
PF00675Peptidase_M16 0.48
PF14535AMP-binding_C_2 0.48
PF02321OEP 0.48
PF01012ETF 0.48
PF02518HATPase_c 0.48
PF09695YtfJ_HI0045 0.48
PF00009GTP_EFTU 0.48
PF03088Str_synth 0.48
PF01728FtsJ 0.48
PF13193AMP-binding_C 0.48
PF01797Y1_Tnp 0.48
PF01706FliG_C 0.48
PF13514AAA_27 0.48
PF00085Thioredoxin 0.48
PF03358FMN_red 0.48
PF08245Mur_ligase_M 0.48
PF08843AbiEii 0.48
PF13847Methyltransf_31 0.48
PF06245DUF1015 0.48
PF13426PAS_9 0.48
PF02579Nitro_FeMo-Co 0.48
PF00571CBS 0.48
PF07509DUF1523 0.48
PF01656CbiA 0.48
PF12837Fer4_6 0.48
PF00011HSP20 0.48
PF03544TonB_C 0.48
PF01558POR 0.48
PF01048PNP_UDP_1 0.48
PF06429Flg_bbr_C 0.48
PF02780Transketolase_C 0.48
PF16916ZT_dimer 0.48
PF02782FGGY_C 0.48
PF01612DNA_pol_A_exo1 0.48
PF02915Rubrerythrin 0.48
PF01880Desulfoferrodox 0.48
PF00834Ribul_P_3_epim 0.48
PF02082Rrf2 0.48
PF00465Fe-ADH 0.48
PF08501Shikimate_dh_N 0.48
PF09924LPG_synthase_C 0.48
PF13188PAS_8 0.48
PF09505Dimeth_Pyl 0.48
PF06827zf-FPG_IleRS 0.48
PF01804Penicil_amidase 0.48
PF02635DrsE 0.48
PF00456Transketolase_N 0.48
PF00583Acetyltransf_1 0.48
PF00903Glyoxalase 0.48
PF07992Pyr_redox_2 0.48
PF02880PGM_PMM_III 0.48
PF02592Vut_1 0.48
PF04290DctQ 0.48
PF01694Rhomboid 0.48
PF12146Hydrolase_4 0.48
PF12724Flavodoxin_5 0.48
PF00464SHMT 0.48
PF13614AAA_31 0.48
PF02493MORN 0.48
PF03588Leu_Phe_trans 0.48
PF02887PK_C 0.48
PF12654DUF3786 0.48
PF13649Methyltransf_25 0.48
PF00925GTP_cyclohydro2 0.48
PF13676TIR_2 0.48
PF07690MFS_1 0.48
PF10431ClpB_D2-small 0.48
PF12281NTP_transf_8 0.48
PF03063Prismane 0.48
PF01476LysM 0.48
PF08443RimK 0.48
PF13407Peripla_BP_4 0.48
PF00438S-AdoMet_synt_N 0.48
PF02219MTHFR 0.48
PF01790LGT 0.48
PF02604PhdYeFM_antitox 0.48
PF00860Xan_ur_permease 0.48
PF04392ABC_sub_bind 0.48
PF04358DsrC 0.48
PF05598DUF772 0.48
PF01042Ribonuc_L-PSP 0.48
PF02618YceG 0.48
PF00892EamA 0.48
PF01243Putative_PNPOx 0.48
PF13247Fer4_11 0.48
PF02661Fic 0.48
PF07731Cu-oxidase_2 0.48
PF13414TPR_11 0.48
PF03951Gln-synt_N 0.48
PF06969HemN_C 0.48
PF00694Aconitase_C 0.48
PF13404HTH_AsnC-type 0.48
PF13440Polysacc_synt_3 0.48
PF00849PseudoU_synth_2 0.48
PF14803Nudix_N_2 0.48
PF00347Ribosomal_L6 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 209 Family Scaffolds
COG0696Phosphoglycerate mutase (BPG-independent), AlkP superfamilyCarbohydrate transport and metabolism [G] 1.44
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.96
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.96
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.96
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.96
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.96
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.96
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 0.96
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.96
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.96
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.96
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.48
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.48
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.48
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.48
COG2033Desulfoferrodoxin, superoxide reductase-like (SORL) domainEnergy production and conversion [C] 0.48
COG2086Electron transfer flavoprotein, alpha and beta subunitsEnergy production and conversion [C] 0.48
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.48
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.48
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.48
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.48
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.48
COG2360Leu/Phe-tRNA-protein transferasePosttranslational modification, protein turnover, chaperones [O] 0.48
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.48
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.48
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.48
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.48
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 0.48
COG2920Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)Translation, ribosomal structure and biogenesis [J] 0.48
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.48
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.48
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 0.48
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.48
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 0.48
COG4311Sarcosine oxidase delta subunitAmino acid transport and metabolism [E] 0.48
COG4642Uncharacterized conserved proteinFunction unknown [S] 0.48
COG4786Flagellar basal body rod protein FlgGCell motility [N] 0.48
COG4787Flagellar basal body rod protein FlgFCell motility [N] 0.48
COG0021TransketolaseCarbohydrate transport and metabolism [G] 0.48
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.48
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.48
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.48
COG0097Ribosomal protein L6P/L9ETranslation, ribosomal structure and biogenesis [J] 0.48
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.48
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.48
COG0169Shikimate 5-dehydrogenaseAmino acid transport and metabolism [E] 0.48
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.48
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.48
COG0192S-adenosylmethionine synthetaseCoenzyme transport and metabolism [H] 0.48
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.48
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.48
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.48
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.48
COG0375Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertionPosttranslational modification, protein turnover, chaperones [O] 0.48
COG04224-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiCCoenzyme transport and metabolism [H] 0.48
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.48
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.48
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.48
COG0635Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductaseCoenzyme transport and metabolism [H] 0.48
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.48
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.48
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.48
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 0.48
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.48
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.48
COG0807GTP cyclohydrolase IICoenzyme transport and metabolism [H] 0.48
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.48
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.48
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.48
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.48
COG1151Hydroxylamine reductase (hybrid-cluster protein)Energy production and conversion [C] 0.48
COG1152CO dehydrogenase/acetyl-CoA synthase alpha subunitEnergy production and conversion [C] 0.48
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.48
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.48
COG1256Flagellar hook-associated protein FlgKCell motility [N] 0.48
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 0.48
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.48
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.48
COG1536Flagellar motor switch protein FliGCell motility [N] 0.48
COG1558Flagellar basal body rod protein FlgCCell motility [N] 0.48
COG1559Endolytic transglycosylase MltG, terminates peptidoglycan polymerizationCell wall/membrane/envelope biogenesis [M] 0.48
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.48
COG1738Queuosine precursor transporter YhhQ, DUF165 familyTranslation, ribosomal structure and biogenesis [J] 0.48
COG1749Flagellar hook protein FlgECell motility [N] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.21 %
UnclassifiedrootN/A26.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10174300Not Available514Open in IMG/M
3300000872|JGI12365J12839_1000700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales9325Open in IMG/M
3300000872|JGI12365J12839_1001085All Organisms → cellular organisms → Bacteria4667Open in IMG/M
3300000920|JGI12573J12842_1000126All Organisms → cellular organisms → Bacteria54648Open in IMG/M
3300000920|JGI12573J12842_1000165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae46129Open in IMG/M
3300000920|JGI12573J12842_1000233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria34265Open in IMG/M
3300000920|JGI12573J12842_1000348All Organisms → cellular organisms → Bacteria24258Open in IMG/M
3300000920|JGI12573J12842_1000563All Organisms → cellular organisms → Bacteria → Proteobacteria13504Open in IMG/M
3300000920|JGI12573J12842_1000708All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae9312Open in IMG/M
3300000920|JGI12573J12842_1003853Not Available1364Open in IMG/M
3300001685|JGI24024J18818_10006019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5031Open in IMG/M
3300001685|JGI24024J18818_10138090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria736Open in IMG/M
3300002052|SMTZ1_10030859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5083Open in IMG/M
3300003142|Ga0052242_1023284Not Available860Open in IMG/M
3300003777|Ga0049110_10063389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax800Open in IMG/M
3300003817|Ga0056122_10037121Not Available1046Open in IMG/M
3300004109|Ga0008650_1058783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1055Open in IMG/M
3300004212|Ga0066631_10091780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1424Open in IMG/M
3300004974|Ga0066617_1274712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans673Open in IMG/M
3300005588|Ga0070728_10007992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria9498Open in IMG/M
3300005600|Ga0070726_10003389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria13414Open in IMG/M
3300005753|Ga0077776_1023412Not Available1762Open in IMG/M
3300005917|Ga0075115_10124893Not Available922Open in IMG/M
3300005917|Ga0075115_10289002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium554Open in IMG/M
3300005920|Ga0070725_10440590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria583Open in IMG/M
3300005932|Ga0075121_1040253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1711Open in IMG/M
3300005932|Ga0075121_1070245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1197Open in IMG/M
3300005932|Ga0075121_1179849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfoprunum → Desulfoprunum benzoelyticum649Open in IMG/M
3300006467|Ga0099972_11025699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria561Open in IMG/M
3300009035|Ga0102958_1321375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales542Open in IMG/M
3300009138|Ga0102959_1215213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria623Open in IMG/M
3300009145|Ga0102961_1143826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium636Open in IMG/M
3300009374|Ga0118720_1022547All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis4285Open in IMG/M
3300009506|Ga0118657_11977801Not Available674Open in IMG/M
3300009509|Ga0123573_10240029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans1773Open in IMG/M
3300009788|Ga0114923_10069979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2423Open in IMG/M
3300009788|Ga0114923_10344029All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300009788|Ga0114923_10745968Not Available741Open in IMG/M
3300009788|Ga0114923_11137755All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009788|Ga0114923_11138672Not Available603Open in IMG/M
3300009788|Ga0114923_11286018Not Available569Open in IMG/M
3300009788|Ga0114923_11346192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium556Open in IMG/M
3300009941|Ga0132240_1055164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH16589Open in IMG/M
3300010298|Ga0126325_10000041All Organisms → cellular organisms → Bacteria48778Open in IMG/M
3300010330|Ga0136651_10281464Not Available831Open in IMG/M
3300010330|Ga0136651_10281686Not Available830Open in IMG/M
3300010392|Ga0118731_100946879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales502Open in IMG/M
3300010392|Ga0118731_107851412All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300010392|Ga0118731_112098202All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium570Open in IMG/M
3300010430|Ga0118733_100598437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2194Open in IMG/M
3300010430|Ga0118733_106797597Not Available596Open in IMG/M
3300010430|Ga0118733_107466687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium567Open in IMG/M
3300013098|Ga0164320_10128499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1122Open in IMG/M
3300013098|Ga0164320_10129548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1118Open in IMG/M
3300013098|Ga0164320_10157872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1025Open in IMG/M
3300013098|Ga0164320_10287550All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales787Open in IMG/M
3300013098|Ga0164320_10477610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria631Open in IMG/M
3300013098|Ga0164320_10512204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium612Open in IMG/M
3300013098|Ga0164320_10628227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium561Open in IMG/M
3300013098|Ga0164320_10775825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium514Open in IMG/M
3300013098|Ga0164320_10792046Not Available509Open in IMG/M
3300013099|Ga0164315_10155566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1862Open in IMG/M
3300013099|Ga0164315_10219668Not Available1550Open in IMG/M
3300013099|Ga0164315_10362250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1178Open in IMG/M
3300013099|Ga0164315_10404123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1108Open in IMG/M
3300013099|Ga0164315_10413539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1094Open in IMG/M
3300013099|Ga0164315_10420172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1084Open in IMG/M
3300013099|Ga0164315_10437189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1061Open in IMG/M
3300013099|Ga0164315_10518169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus964Open in IMG/M
3300013099|Ga0164315_10630698All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium862Open in IMG/M
3300013099|Ga0164315_10715759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria802Open in IMG/M
3300013099|Ga0164315_10945731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300013099|Ga0164315_10987015Not Available668Open in IMG/M
3300013099|Ga0164315_11088878All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300013099|Ga0164315_11261016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium583Open in IMG/M
3300013099|Ga0164315_11296185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium574Open in IMG/M
3300013099|Ga0164315_11510500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300013099|Ga0164315_11608152All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300013101|Ga0164313_10187856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1745Open in IMG/M
3300013101|Ga0164313_10354642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1228Open in IMG/M
3300013101|Ga0164313_10403013Not Available1142Open in IMG/M
3300013101|Ga0164313_10534435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum mediterraneum973Open in IMG/M
3300013101|Ga0164313_10557491All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria950Open in IMG/M
3300013101|Ga0164313_10625704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium890Open in IMG/M
3300013101|Ga0164313_11014808Not Available675Open in IMG/M
3300013101|Ga0164313_11029545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium670Open in IMG/M
3300013101|Ga0164313_11470957Not Available549Open in IMG/M
3300013101|Ga0164313_11518861Not Available539Open in IMG/M
3300013101|Ga0164313_11717820All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300013103|Ga0164318_11452943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium551Open in IMG/M
3300013117|Ga0171658_1051222All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300014903|Ga0164321_10009903All Organisms → cellular organisms → Bacteria2837Open in IMG/M
3300014903|Ga0164321_10675413All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300014914|Ga0164311_10611533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata624Open in IMG/M
3300014914|Ga0164311_10675937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus589Open in IMG/M
3300017960|Ga0180429_10529973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria788Open in IMG/M
3300017960|Ga0180429_10833648Not Available624Open in IMG/M
3300017960|Ga0180429_10964038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium580Open in IMG/M
3300017960|Ga0180429_11012848Not Available566Open in IMG/M
3300017990|Ga0180436_11056733All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300017992|Ga0180435_10500313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1014Open in IMG/M
3300017992|Ga0180435_10745038All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300017992|Ga0180435_10901889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont750Open in IMG/M
3300017992|Ga0180435_11465338Not Available590Open in IMG/M
3300017992|Ga0180435_11473669All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018065|Ga0180430_10429833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → Desulfatitalea tepidiphila903Open in IMG/M
3300018065|Ga0180430_10537099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 4 endosymbiont804Open in IMG/M
3300018065|Ga0180430_10965399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium594Open in IMG/M
3300018065|Ga0180430_11075981Not Available563Open in IMG/M
3300018065|Ga0180430_11209660Not Available531Open in IMG/M
3300018065|Ga0180430_11210319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria531Open in IMG/M
3300018065|Ga0180430_11267507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium517Open in IMG/M
3300018080|Ga0180433_10376017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1102Open in IMG/M
3300021511|Ga0190284_1015329All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300022391|Ga0210374_1131555Not Available536Open in IMG/M
3300022552|Ga0212118_10309678Not Available871Open in IMG/M
(restricted) 3300022912|Ga0233430_1237903All Organisms → cellular organisms → Bacteria697Open in IMG/M
(restricted) 3300022913|Ga0233404_10023748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1385Open in IMG/M
(restricted) 3300022913|Ga0233404_10139270Not Available586Open in IMG/M
(restricted) 3300022913|Ga0233404_10150063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfotignum566Open in IMG/M
(restricted) 3300022913|Ga0233404_10160532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
(restricted) 3300023085|Ga0233406_10037218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
(restricted) 3300023085|Ga0233406_10040145Not Available662Open in IMG/M
(restricted) 3300023085|Ga0233406_10040850Not Available658Open in IMG/M
(restricted) 3300023085|Ga0233406_10084473Not Available530Open in IMG/M
(restricted) 3300023085|Ga0233406_10100562Not Available504Open in IMG/M
(restricted) 3300023086|Ga0233407_10023695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038775Open in IMG/M
(restricted) 3300023112|Ga0233411_10075147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1068Open in IMG/M
(restricted) 3300023114|Ga0233405_10067120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria598Open in IMG/M
(restricted) 3300023114|Ga0233405_10072945All Organisms → cellular organisms → Bacteria582Open in IMG/M
(restricted) 3300023114|Ga0233405_10085685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium552Open in IMG/M
(restricted) 3300023210|Ga0233412_10030520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2158Open in IMG/M
(restricted) 3300023271|Ga0233403_10185283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
(restricted) 3300024059|Ga0255040_10332569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont638Open in IMG/M
(restricted) 3300024259|Ga0233437_1395480Not Available504Open in IMG/M
3300024265|Ga0209976_10763712Not Available503Open in IMG/M
(restricted) 3300024338|Ga0255043_10048828Not Available1291Open in IMG/M
(restricted) 3300024338|Ga0255043_10254418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
(restricted) 3300024519|Ga0255046_10095443All Organisms → cellular organisms → Bacteria1256Open in IMG/M
(restricted) 3300024519|Ga0255046_10239264Not Available835Open in IMG/M
(restricted) 3300024528|Ga0255045_10223857All Organisms → cellular organisms → Bacteria740Open in IMG/M
(restricted) 3300024529|Ga0255044_10228149All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-1742Open in IMG/M
(restricted) 3300024529|Ga0255044_10402530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300025814|Ga0210101_1043345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1211Open in IMG/M
3300026968|Ga0207831_100016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae461429Open in IMG/M
3300026968|Ga0207831_100023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae385056Open in IMG/M
3300026968|Ga0207831_100060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae183421Open in IMG/M
3300026975|Ga0207799_100010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae388766Open in IMG/M
3300026975|Ga0207799_100108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria98512Open in IMG/M
3300026975|Ga0207799_100423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae16870Open in IMG/M
3300027021|Ga0207721_113179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium767Open in IMG/M
3300027758|Ga0209379_10095142All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300027820|Ga0209578_10077691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1660Open in IMG/M
3300027828|Ga0209692_10410713Not Available577Open in IMG/M
(restricted) 3300027837|Ga0255041_10294472Not Available586Open in IMG/M
3300027845|Ga0209271_10013131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3295Open in IMG/M
(restricted) 3300027856|Ga0255054_10182393Not Available1032Open in IMG/M
(restricted) 3300027861|Ga0233415_10056985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1648Open in IMG/M
(restricted) 3300027861|Ga0233415_10099444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1279Open in IMG/M
(restricted) 3300027861|Ga0233415_10658389All Organisms → cellular organisms → Bacteria → Aquificae → unclassified Aquificae → Aquificae bacterium512Open in IMG/M
(restricted) 3300027868|Ga0255053_10041948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2186Open in IMG/M
(restricted) 3300027868|Ga0255053_10220852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium913Open in IMG/M
(restricted) 3300027868|Ga0255053_10300016Not Available775Open in IMG/M
(restricted) 3300027868|Ga0255053_10381581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
(restricted) 3300027868|Ga0255053_10382936Not Available680Open in IMG/M
3300027978|Ga0209165_10003746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5127Open in IMG/M
(restricted) 3300027996|Ga0233413_10034579Not Available1917Open in IMG/M
(restricted) 3300027996|Ga0233413_10063479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1443Open in IMG/M
(restricted) 3300027996|Ga0233413_10103275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1150Open in IMG/M
(restricted) 3300027996|Ga0233413_10279178Not Available715Open in IMG/M
(restricted) 3300027996|Ga0233413_10326583Not Available663Open in IMG/M
3300028026|Ga0256846_1015167All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300028026|Ga0256846_1036252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1084Open in IMG/M
3300028026|Ga0256846_1036769Not Available1078Open in IMG/M
3300028026|Ga0256846_1084164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria775Open in IMG/M
3300028026|Ga0256846_1116102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria679Open in IMG/M
3300028026|Ga0256846_1138801All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300028029|Ga0256845_1078041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1201Open in IMG/M
3300028029|Ga0256845_1089464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1096Open in IMG/M
(restricted) 3300028045|Ga0233414_10061633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina1563Open in IMG/M
(restricted) 3300028045|Ga0233414_10194900Not Available908Open in IMG/M
3300028195|Ga0257125_1056792All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300031276|Ga0307441_1225847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes533Open in IMG/M
3300031727|Ga0316576_11198389Not Available536Open in IMG/M
3300032137|Ga0316585_10043777Not Available1430Open in IMG/M
3300032231|Ga0316187_10051047All Organisms → cellular organisms → Bacteria → Proteobacteria3304Open in IMG/M
3300032231|Ga0316187_10069330All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300032231|Ga0316187_10285280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1261Open in IMG/M
3300032231|Ga0316187_10411922Not Available1020Open in IMG/M
3300032251|Ga0316198_10000004All Organisms → cellular organisms → Bacteria → Proteobacteria86778Open in IMG/M
3300032251|Ga0316198_10005174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae8041Open in IMG/M
3300032251|Ga0316198_10011838All Organisms → cellular organisms → Bacteria5419Open in IMG/M
3300032251|Ga0316198_10028952Not Available3390Open in IMG/M
3300032252|Ga0316196_10099504Not Available1350Open in IMG/M
3300032258|Ga0316191_10010972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS56885Open in IMG/M
3300032262|Ga0316194_10139736All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300032272|Ga0316189_10042230All Organisms → cellular organisms → Bacteria3953Open in IMG/M
3300032272|Ga0316189_10314188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax1220Open in IMG/M
3300032272|Ga0316189_10502867All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300032272|Ga0316189_10894163Not Available674Open in IMG/M
3300032272|Ga0316189_10926250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium661Open in IMG/M
3300032272|Ga0316189_11119621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium595Open in IMG/M
3300032273|Ga0316197_10064345All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Aureliella → Aureliella helgolandensis2351Open in IMG/M
3300033429|Ga0316193_10196046All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae1597Open in IMG/M
3300033429|Ga0316193_11238922Not Available592Open in IMG/M
3300033429|Ga0316193_11322857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria572Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment20.57%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater16.27%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment8.61%
Aerobic Enrichment MediaEngineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media7.66%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment5.26%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment5.26%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow5.26%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface4.31%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.31%
Tube Worm SurfaceHost-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface3.83%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake2.39%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.91%
Marine Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent1.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.44%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.96%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.48%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.48%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.48%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.48%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.48%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.48%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.48%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.48%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.48%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.48%
Marine SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment0.48%
Deep-Sea Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent0.48%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat0.48%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.48%
Marine Gutless Worms SymbiontHost-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont0.48%
Marine Gutless Worms SymbiontHost-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont0.48%
Marine Gutless WormsHost-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms0.48%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000872Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2EngineeredOpen in IMG/M
3300000920Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2)EngineeredOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300002052Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30EnvironmentalOpen in IMG/M
3300003142Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsfEnvironmentalOpen in IMG/M
3300003777Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2Host-AssociatedOpen in IMG/M
3300003817Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLANDHost-AssociatedOpen in IMG/M
3300004109Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_150m_DNAEnvironmentalOpen in IMG/M
3300004212Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00EnvironmentalOpen in IMG/M
3300004974Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_200m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005753Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assemblyEnvironmentalOpen in IMG/M
3300005917Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKHEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300005932Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKGEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300009374Combined Assembly of Gp0137041, Gp0137043EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300009941Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 12m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010298Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaGHost-AssociatedOpen in IMG/M
3300010330Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013117Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 900m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300014914Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cmEnvironmentalOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300021511Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MGEnvironmentalOpen in IMG/M
3300022391Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022552Guaymas_combined assemblyEnvironmentalOpen in IMG/M
3300022912 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MGEnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023086 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023271 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024265Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024338 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025814Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026968Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes)EngineeredOpen in IMG/M
3300026975Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2 (SPAdes)EngineeredOpen in IMG/M
3300027021Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P2 (1) (SPAdes)EngineeredOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028026Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - TevniaHost-AssociatedOpen in IMG/M
3300028029Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - RiftiaHost-AssociatedOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028195Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_200EnvironmentalOpen in IMG/M
3300031276Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300032137Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrCHost-AssociatedOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1017430013300000124MarineMLASVHLEMVDFGFRQGPSEFSTAGIARYFEDWKRERTPPGAERCR
JGI12365J12839_100070033300000872Aerobic Enrichment MediaMVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK*
JGI12365J12839_100108513300000872Aerobic Enrichment MediaMVDFGSEQGLSDFSRDGTSRLIYSLRWVETAGIVDYFEDFKRAKTPLGAKDAF
JGI12573J12842_1000126483300000920Aerobic Enrichment MediaMVDFGFEQGLSDLETAGIVDYFEDFQRAKTPLGAKRCRL*
JGI12573J12842_100016523300000920Aerobic Enrichment MediaMVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI*
JGI12573J12842_100023313300000920Aerobic Enrichment MediaMVDFGSEQGLSDFETAGIVNYFEDFKRAKTPLGAKRCH
JGI12573J12842_1000348143300000920Aerobic Enrichment MediaMVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI*
JGI12573J12842_100056313300000920Aerobic Enrichment MediaMVDFGFEQGLSDFETAGIVDYFEDFKRAKTPLGAKRC
JGI12573J12842_100070813300000920Aerobic Enrichment MediaMVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLW
JGI12573J12842_100385313300000920Aerobic Enrichment MediaVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI*
JGI24024J18818_1000601913300001685MarineSVRPQMVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDTN*
JGI24024J18818_1013809013300001685MarineMVDFGSGQGLSDFETGGITCYFEDFKRAKTPLRAERCRLWIVTNPLRAIE
SMTZ1_10030859113300002052Marine SedimentMVDFGFRQGPSEFSTAGIARYFEDWKRARTPPGAEICRLWMDNS*
Ga0052242_102328423300003142Marine SedimentMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK*
Ga0049110_1006338923300003777Marine Gutless Worms SymbiontVSVHPEMIDFGSEQGLSDFETVGIVRYFEDFKRAKTPLWAKRCRLWMGTI*
Ga0056122_1003712123300003817Marine Gutless Worms SymbiontMVDFGSERGLSDFETAGIVSYSEDFKRAKTLLWSQPVDA*
Ga0008650_105878323300004109MarineIVDFGSEQGLSNFETGGIARHFEDFIIAKTQLRAKRCCLWLDTT*
Ga0066631_1009178023300004212GroundwaterMVDFGSERGLSVFEAAGITCYFEDFKKAKTKLWAKRRRLWMDTNYQEPAVHRFQQV*
Ga0066617_127471233300004974MarineMIDFGSGQGLNIFATAGIARYFEDCKKVKTPAWAKRCRFWM
Ga0070728_10007992113300005588Marine SedimentMVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERCRLWMDNRKELT*
Ga0070726_10003389123300005600Marine SedimentMVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERYRLWMDNRKELT*
Ga0077776_102341213300005753Deep-Sea Hydrothermal VentDFGSEQGLSNFETGGIAVGYVEDFKIAKTPLWAKRCCL*
Ga0075115_1012489323300005917Saline LakeMVDFGSEQGLSDFETDSVAVIVSTGIARYFEDFKKAKTKLWAKRCRFWIGTSHVKSRKMCT*
Ga0075115_1028900223300005917Saline LakeMVGFGSEQGLSDFETTGIACYFEDFKRAKTKLRAKRCRLWM
Ga0070725_1044059013300005920Marine SedimentMVDFGPEQGLSDFETDGEAVTATAGVAGYVEDLKRAKTPLRAKRCRLWMGT
Ga0075121_104025313300005932Saline LakeSVHPEMVDFGSEQGLSDFKTAGIARYFEDFKRAKTKLWAKRCRLWMCTSYTI*
Ga0075121_107024513300005932Saline LakeEMVDFGSEQGLSDFESAGIACYFEDFKRAKTKLWAKRCRLWMDTKIKNFQERR*
Ga0075121_117984923300005932Saline LakeMVDFGSEQGLSDFETAGIACYFEDFKKAKTKLRAKRCRFWMGTK*
Ga0099972_1102569913300006467MarineMVAFGSEQGLSNFETAGIVHYSEDFKGAKTQLWAKRCHFWMG
Ga0102958_132137523300009035SoilMVAFGSEQGLSDFKTAGIVRYFEDFKKAKTPLWAKRCRL*
Ga0102959_121521313300009138SoilMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTR*
Ga0102961_114382623300009145SoilMVGFGSERGLNDFETAGIARYSEDLKIVKTLLWAERCRLWMDAKENPQ*
Ga0118720_102254733300009374MarineMVDFGSEQGLSAFETAGIVNYFEDFKRAKTPLRAERCRLWTGTN*
Ga0118657_1197780113300009506Mangrove SedimentMADFGSGQGLNDFETGGIACYFEDFKRAKTPPRVER
Ga0123573_1024002923300009509Mangrove SedimentMVDFGSEQGLSDFETAGIVSYFEDYKRAKTPLGVKRCHFWMGTN*
Ga0114923_1006997933300009788Deep SubsurfaceMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTI*
Ga0114923_1034402923300009788Deep SubsurfaceMDRNITSVRPQMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTN*
Ga0114923_1074596823300009788Deep SubsurfaceMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKR
Ga0114923_1093470013300009788Deep SubsurfaceRPFFNTNILLTSVLPQMVDFGSEQGLSNFETAGIAGYVEDFKRTKTPLWAKRCRLWMDTKIH*
Ga0114923_1113775513300009788Deep SubsurfaceNLVSVRPQMVDFGSEQGLSNFETDGVAVPALAGIAGYIEDFKRAKTPLRAKRCRLWMDTS
Ga0114923_1113867223300009788Deep SubsurfaceVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTI*
Ga0114923_1128601813300009788Deep SubsurfaceMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAK
Ga0114923_1134619213300009788Deep SubsurfaceVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMDTNWFDFGIDKYFI*
Ga0132240_105516423300009941Meromictic PondMVDFGSERGLSVFETTGIAGYFEDFKKAKTKCWAKRCHL
Ga0126325_10000041303300010298Marine Gutless WormsMVVFGLEQGLSDLETAGIAGYSEDFKVAKTPLWAKRCRLWMGTN*
Ga0136651_1028146413300010330Marine Hydrothermal VentVDFGSQQGLSDFETTGIVGYVEDFKRAKTQLRAKRCCLWMDTN*
Ga0136651_1028168623300010330Marine Hydrothermal VentMVDFGLQQGLSDFETTGIVSYVEDFRRAKTPLRAQRCRLWMDIT*
Ga0118731_10094687913300010392MarineMVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMEPTKLLVVLC*
Ga0118731_10785141223300010392MarineMVDFGSEQGLSYFEIDGEAVPALAGIAGYFEDFKRAKTPLRAKRCRLWMGTN*
Ga0118731_11209820223300010392MarineMVDFGSEQGLSDFETGGIAGYVEDFKRAKTPLWAKRCRLWTDTI*
Ga0118733_10059843733300010430Marine SedimentMVDFGPEQGLSDFETGGVVGYVEDLKRVKTPLRAKRCRLWLDTN*
Ga0118733_10679759713300010430Marine SedimentMVDFGSEQGLSDFESTGIAGYFEEFKRAKTPLWAKRCRLWMGTIEEKSI*
Ga0118733_10746668713300010430Marine SedimentMVDFGSGQGLSDFETGGIALYFEDFKRSKTPPRAERCCLWMDTEPGLTGP*
Ga0164320_1012849913300013098Marine SedimentMVDIGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWM
Ga0164320_1012954823300013098Marine SedimentDSVRPQMVDFGSEQGLSNFETADIAGYVEDFKRAKTPLWAKRCRLWMDTG*
Ga0164320_1015787213300013098Marine SedimentVRPQMVDLGSEQGLSNFETAGIAGYVEDLKRAKTPLWAKRCRLRMDTN*
Ga0164320_1022263223300013098Marine SedimentLSGLKEKAVVYILRNSVRPQMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTK*
Ga0164320_1028755013300013098Marine SedimentVDIGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMDTN*
Ga0164320_1047761013300013098Marine SedimentSTQKFGFFSNLVSVRPQRVDFGSEQGLSNFETGGIAGYVEDFKRAKTPLWGKRCRLWMDTN*
Ga0164320_1051220413300013098Marine SedimentMVSVRPQMVDVGSEQGLSNFETAGIAGYFEDFKRAKTPLWAKRCRLWMGTN*
Ga0164320_1062822713300013098Marine SedimentDFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTS*
Ga0164320_1077582513300013098Marine SedimentFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTI*
Ga0164320_1079204613300013098Marine SedimentSNFETAGIAGYVEDFKRAKTPLWAKRCCLWMGTN*
Ga0164315_1015556613300013099Marine SedimentDFGSEQGLSDFETAGIASYSEDFKRAKTPLRAERCRLWMGTK*
Ga0164315_1021966823300013099Marine SedimentMVDFGSEQGLIDFETASIAGYSEGFKRAKTPLRAKR
Ga0164315_1036225023300013099Marine SedimentMVDFGSEQGLSDFETNGVAVSAIAGIVGYVEDFKR
Ga0164315_1040412313300013099Marine SedimentIIIKNSVRPQMVDFGSKQGLSDFETAGIASYVEDFKRAKTPLRAKRCRLWMGTTSQG*
Ga0164315_1041353913300013099Marine SedimentEQGLSDFETAGIARYSEEFKRAKTPLWAKRCRLWMGTI*
Ga0164315_1042017223300013099Marine SedimentVRPQMVDFGSEQGLSDFETAGIVGYVEDFKRAKTPLRAKRCRLWMDTR*
Ga0164315_1043718913300013099Marine SedimentFGSEQGLSDFESAVIASYFEEFKRAKTPLWAKRCRLWMDTLGDYKDHTGL*
Ga0164315_1051816913300013099Marine SedimentEQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK*
Ga0164315_1063069823300013099Marine SedimentDFGSEQGLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMGTKYKG*
Ga0164315_1071575923300013099Marine SedimentMVDFGSEQGLSDFETAGIAGYSEEFKRAKTPHWIKRCRLWTGTI*
Ga0164315_1094573123300013099Marine SedimentDFGSEQGLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMDTNSLL*
Ga0164315_1098701523300013099Marine SedimentMVDFGSEQGLSYFETAGIAGYVEEFKIAKTPPWAKRCRLWMGAI*
Ga0164315_1108887813300013099Marine SedimentQDSVRPEMVDFGSGQGLNVFETAGIAGYSEEFKKVKTQPWAERCRLWMGTS*
Ga0164315_1126101623300013099Marine SedimentMVDFGSEQGLSDFETAGIVRYSEDFRRAKTPLWAKRCRLWMGTSYKNTPPSIGKVRGTS*
Ga0164315_1129618513300013099Marine SedimentMVDFGLQQGLSDFETTSIVSYVEDFRRAKTPLRAQRCRLWMDIT*
Ga0164315_1151050013300013099Marine SedimentGLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMGTH*
Ga0164315_1160815213300013099Marine SedimentMVDFGSEQGLSYFETAGIAGYVEDFKRAKTPLWAKKCRLWMG*
Ga0164313_1018785623300013101Marine SedimentMVDFGSEQGLSDFETAGIARYSEEFKRAKTPLWAKRCRLWMGTS*
Ga0164313_1035464223300013101Marine SedimentMVDFGSEQGLSYFETAGIAGYVEDFKIAKTPLWAKRCRLWMGTI*
Ga0164313_1040301323300013101Marine SedimentMVDFGSGQGLNVFETAGIAGYSEEFKKVKTQPWAERCRLWMGTMLILGLFFT
Ga0164313_1053443523300013101Marine SedimentMTQANSVRPQMVDFGSEQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK*
Ga0164313_1055749123300013101Marine SedimentMVDFGSEQGLSDFETNGVAVSAIAGIVGYVEDFKRAKTPLWAKRCRLWMGTN*
Ga0164313_1062570413300013101Marine SedimentVSVRPEMVDFGSEQGLSDFETAGIAGYSEEFKRAKTPLWAKRCRLWMSTS*
Ga0164313_1101480813300013101Marine SedimentMVDFGSEQGLSDFETAGIASYSEDFKRAKTPLRAERCRLWMGTK*
Ga0164313_1102954533300013101Marine SedimentMVDFGSEQGLSDFETAGIARYVEEFKRAKTPLWAKRCRLWMGT
Ga0164313_1147095723300013101Marine SedimentVRPQMVDFGSEQGLSYFETAGIAGYVEDFKRAKTPLWAKKCRLWMG*
Ga0164313_1151886113300013101Marine SedimentMVGFGSRQGLNVFETAGIAGYSEDFKKVKTQPWAKRCRLWM
Ga0164313_1171782013300013101Marine SedimentEMVDFGSEQGLSDFETAGIAGYSEDFKRAKTPLWAKRCRLWMGTS*
Ga0164318_1145294313300013103Marine SedimentMVDFGSEQGLSDFETAGIARYVEEFKRAKTPLWDKRCRLWMGTH*
Ga0171658_105122223300013117MarineDFFNHFIVGVSPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAGRCRLWIDTN*
Ga0164321_1000990323300014903Marine SedimentMVLYQNIFLLLTSVHPQMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRGERCRLWAGTN*
Ga0164321_1067541313300014903Marine SedimentMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRL
Ga0164311_1061153313300014914Marine SedimentMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTK*
Ga0164311_1067593713300014914Marine SedimentMTQANSVRPQMVDFGSKQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK*
Ga0180429_1052997313300017960Hypersaline Lake SedimentFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTR
Ga0180429_1083364833300017960Hypersaline Lake SedimentMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGT
Ga0180429_1096403823300017960Hypersaline Lake SedimentPEMVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK
Ga0180429_1101284823300017960Hypersaline Lake SedimentFGSEQGLSNLEAGVIARYFEDLQRAKTQLWADGTPRAL
Ga0180436_1105673313300017990Hypersaline Lake SedimentMDFLIVQGLTSVRPEMVGFGSEQGMSDFEIGVITGYFEDFKRVKTPLWAKRCRLWTGNRG
Ga0180435_1050031313300017992Hypersaline Lake SedimentMADFGSGQGLSDLETGGIARYFEGFQRAKTPLWAKRCRLWVGN
Ga0180435_1074503813300017992Hypersaline Lake SedimentMVDFDSEQGLSDFETAGIARYFEDFIRVKTPLWIKKCRLWMGNP
Ga0180435_1090188923300017992Hypersaline Lake SedimentSVRPEMVDFGSEQGLSDFETAGIAGYSEAFKRAKTPLWAKRCRLFCL
Ga0180435_1146533823300017992Hypersaline Lake SedimentMVDFGFGQGLSDIETAGIVGYFEDFKRAKTPLGTKRCRLLMGTNE
Ga0180435_1147366913300017992Hypersaline Lake SedimentMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCR
Ga0180430_1042983323300018065Hypersaline Lake SedimentMVNFGSGQGLNDLEAGEIAGYFEDFQRAKTQPWAERCRLWMDTIYETALGIA
Ga0180430_1053709933300018065Hypersaline Lake SedimentMVGFGSEQGLSDFEPAGIVRYFEELKRAKTPLWAKRCHLLMGTY
Ga0180430_1096539923300018065Hypersaline Lake SedimentMVDFGSEQGLSDFETTGIARYFEDLKIAKTPLWAKRCRLWMDTNRCVQLFHPKTGC
Ga0180430_1107598123300018065Hypersaline Lake SedimentMVDFGSEQGLSDFETAGIARYSEEFKKAKTPLWAERCRLWMGTI
Ga0180430_1120966023300018065Hypersaline Lake SedimentMVDFGSEQGLSDFESAGIVHYFEEFKRAKTPLWAKRCRLWADTIWRAS
Ga0180430_1121031923300018065Hypersaline Lake SedimentMVDFGSEQGLSDFETGVITGYFEDFKRAKTPLWTVICHLWMGTE
Ga0180430_1126750723300018065Hypersaline Lake SedimentMVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK
Ga0180433_1037601723300018080Hypersaline Lake SedimentMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTN
Ga0190284_101532923300021511Hydrothermal Vent Microbial MatMVDFGLQQGLSDFETTGIVSYVEDFKRAKTPLRAKRCRLWMDIT
Ga0210374_113155513300022391EstuarineMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPGAERCRLWMEN
Ga0212118_1030967823300022552Marine Hydrothermal VentYLSCLSDSVLPQMVDFGLQQGLSDFETTGIVGYVEDFKRAKTQLRAKRCCLWMDTN
(restricted) Ga0233430_123790313300022912SeawaterGSGQGINDFETTGIAGYFEDFKKVKTPPWAERCRLRTRTKKR
(restricted) Ga0233404_1002374813300022913SeawaterMVDFGSKQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP
(restricted) Ga0233404_1013927013300022913SeawaterTYYTGVHPQMVDFGSEQGLSDSETGGIARYSEDLKIVKTPLWAKRCRLWVDTN
(restricted) Ga0233404_1015006333300022913SeawaterMVDFGSEQGLSDFETAGIAGYVEDFKRAKTPLWAKRCHLW
(restricted) Ga0233404_1016053213300022913SeawaterFGSEQGLSNFETAGIAGYSEDFKRAKTPLWAERCRLWMGTK
(restricted) Ga0233406_1003721823300023085SeawaterMLYLFSVHPQMVDFGSGQGLSDFETAGIAGYSEDFKRAKTPLWAERCRLWMGTK
(restricted) Ga0233406_1004014513300023085SeawaterLIFTAAPLVCVCPQVVAFDSEQGLSDFETAGIVRYIEESKIAKTPLCAKRCRLWMDTI
(restricted) Ga0233406_1004085013300023085SeawaterMVDFGSEQGLSDFETAGIARYSEDLKIAKTPLWAKRCRLWM
(restricted) Ga0233406_1008447313300023085SeawaterMVDFGSEQGLSDFETAVIAGYVEEFKRAKTPLWAKRGR
(restricted) Ga0233406_1010056223300023085SeawaterMVDFGSEQGLSDFETAGTADYVEEFKRAKTPLRAKRCRLWMGTSVCPQMVDFGSEQGLSDFE
(restricted) Ga0233407_1002369523300023086SeawaterMSGSLASVHPQMVDFGSEQGLSYFETGGIAVYVADFKRAKTPPWAKRCRL
(restricted) Ga0233411_1007514723300023112SeawaterMVDFGSEQGLSDFETAGIARYSEDFKRAKTLLWAERCRLWMGTI
(restricted) Ga0233405_1006712023300023114SeawaterDFGSKQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP
(restricted) Ga0233405_1007294523300023114SeawaterMHIRSPIFSELFSVRPQIVDFGSEQGLSNFETAGIASYVEDFKRAKTPLWAERCCLWMDT
(restricted) Ga0233405_1008568523300023114SeawaterLTSVHPEMVDFGSEQGLSDFETAGIASYSEDFERAKTQL
(restricted) Ga0233412_1003052043300023210SeawaterMVDFGSEQGLSDFESAGIVRYFEEFKRAKTPLWAKRCRLWMGII
(restricted) Ga0233403_1018528313300023271SeawaterVGFGLGQGLNVFETGGIVGYSEDFKKVKTQPWAKRCPLWRDTI
(restricted) Ga0255040_1033256913300024059SeawaterVDFGPEQGLSDFETGGVAGYVEDFKRAKTPLRAKRCRLGMDT
(restricted) Ga0233437_139548013300024259SeawaterMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTN
Ga0209976_1076371223300024265Deep SubsurfaceMVDFGSEQGLSNFETDGVAVPALAGIAGYIEDFKRAKTPLRAKRCRLWMDTS
(restricted) Ga0255043_1004882813300024338SeawaterMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRAERCRLWMETK
(restricted) Ga0255043_1025441813300024338SeawaterMIDFGSGQGLNDFETGGIACYFEDFEREKTPPRAERCRLWMGTG
(restricted) Ga0255046_1009544323300024519SeawaterMKIFLFSVRPQMTDFGSRQGLSDFETGGIACYFEDFKREKTLPRAERCRLWMGTI
(restricted) Ga0255046_1023926423300024519SeawaterNFAIVRSQMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK
(restricted) Ga0255045_1022385723300024528SeawaterSAHPEMVNFGSGQGLSDFETGGIACYFEDFKRAKTLPRAERCLL
(restricted) Ga0255044_1022814923300024529SeawaterMVDFGSGQGLSDFETGGIACYFEDFKIAKTPPRGERCRLWM
(restricted) Ga0255044_1040253013300024529SeawaterPEMVNFGSGQGLGDFETGGIACYFEDFKRAKTLPRAERCLL
Ga0210101_104334523300025814Natural And Restored WetlandsMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAER
Ga0207831_1000162953300026968Aerobic Enrichment MediaMVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI
Ga0207831_1000233013300026968Aerobic Enrichment MediaMVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI
Ga0207831_100060663300026968Aerobic Enrichment MediaMVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI
Ga0207799_1000101543300026975Aerobic Enrichment MediaMVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK
Ga0207799_100108413300026975Aerobic Enrichment MediaMYGSPLTSARPEMVDFGFGQGLSDFETAGIVGYFEDFKRAKTPLGSKRCRL
Ga0207799_100423153300026975Aerobic Enrichment MediaMVDFGFEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCRF
Ga0207721_11317923300027021Aerobic Enrichment MediaMVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGTKRCHLWMDTT
Ga0209379_1009514223300027758Marine SedimentMVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERCRLWMDNRKELT
Ga0209578_1007769113300027820Marine SedimentMVDFVSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDTN
Ga0209692_1041071313300027828Marine SedimentQIVDFGSGQGLSDFETGGIACYFEDFKRTKTPPRVERCRN
(restricted) Ga0255041_1029447223300027837SeawaterMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDT
Ga0209271_1001313113300027845Marine SedimentMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWM
(restricted) Ga0255054_1018239313300027856SeawaterMVGFGSEQGLSNFETGGVAGYVEDLKRAKTPLLAKRCRLWM
(restricted) Ga0233415_1005698523300027861SeawaterMVDFASEQGLSAFETTGIAGYVEDFKRAKTPLWAKRCRLWVGTNQAMEVS
(restricted) Ga0233415_1009944413300027861SeawaterSVHPEMVDFGSEQGLSDFETAGIARYSEDFERAKTQLRA
(restricted) Ga0233415_1065838923300027861SeawaterKNKLPIVHPEMVDFGSEQGLSDFETAGIACYFEDFKRAKTPLWAKRCRFWTDTH
(restricted) Ga0255053_1004194823300027868SeawaterMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK
(restricted) Ga0255053_1022085213300027868SeawaterMVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRTKRCRLWMG
(restricted) Ga0255053_1030001623300027868SeawaterYPALPRVTLVSVRPQMVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRAKRCRLWMDTS
(restricted) Ga0255053_1038158133300027868SeawaterVSVRPQMVGFGSEQGLSNFETGGVAGYVEDLKRAKTPLWAKRYRLWMGTS
(restricted) Ga0255053_1038293613300027868SeawaterEANPPLIVSVRPQMVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRGKRCRLWIGTS
Ga0209165_1000374613300027978Marine SedimentMVDFVSGQGLSDFETGGIACYFEDFKRAKTPPRAERC
(restricted) Ga0233413_1003457913300027996SeawaterGSEQGLSDFETAGIARYSEDFKRAKTLLWAERCRLWMGTI
(restricted) Ga0233413_1006347913300027996SeawaterMVDFGSEQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP
(restricted) Ga0233413_1010327513300027996SeawaterDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAKRCRLWMGTR
(restricted) Ga0233413_1027917823300027996SeawaterGSEQGLSDFESAGIVHYFEEFKRAKTPLWAKRCRLWMGII
(restricted) Ga0233413_1032658313300027996SeawaterMVGFGSGQGLNVFETAGIAGYSEDFKKVKTQPWAKKCRLWMGTI
Ga0256846_101516723300028026Tube Worm SurfaceMVDFGSGQGLSDFETAGIAGYVEDFKRAKTQPWAKRCRLWMDTS
Ga0256846_103625213300028026Tube Worm SurfaceFGSGQGLSDFETAGIAGYFEDFKRAKTQPWAKRCRLWMGTSYI
Ga0256846_103676913300028026Tube Worm SurfaceGSGQGLSDFETAGIAGYSEDFKRAKTPPWAERCRLWMGTNL
Ga0256846_108416413300028026Tube Worm SurfaceMVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTI
Ga0256846_111610213300028026Tube Worm SurfaceMVDFGSGQGLSDFETAGIAGYSEDFKKAKTQPWAERC
Ga0256846_113880113300028026Tube Worm SurfaceVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTS
Ga0256845_107804113300028029Tube Worm SurfaceMVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTNYGAI
Ga0256845_108946423300028029Tube Worm SurfaceMVDFGSGQGLSDFETAGIAGYFEDFKRAKTQPWAERCRLWMGNN
(restricted) Ga0233414_1006163323300028045SeawaterMVDFGSGQGLNVFETAGIAGYSEDFKKVKTQPWAKRCLLWRDTI
(restricted) Ga0233414_1019490013300028045SeawaterMVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAKRCR
Ga0257125_105679233300028195MarineMVDFGSGQGLNIFATAGIARYFEDCKKVKTPAWAKRCRFWMDIICYTP
Ga0307441_122584713300031276Salt MarshCVRPEMVDFGSEQGLSNFETAVIAGYFEDFKRAKTPPRAERCRLWTDTNYLQVT
Ga0316576_1119838913300031727RhizosphereMVYFGSEQGLNEFETAVEMRYFEDFKRVKTPLWAKRFHLWMG
Ga0316585_1004377733300032137RhizosphereMVDFGFAQGLSDFETGGIVGYFEDFKRAKTPLEAKRCLLWMGTHQ
Ga0316187_1005104743300032231Worm BurrowQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPKAERCRLWMDTN
Ga0316187_1006933033300032231Worm BurrowVYPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDNRKELT
Ga0316187_1028528043300032231Worm BurrowMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCR
Ga0316187_1041192223300032231Worm BurrowGLSDFETGGIACYFEDFKRAKKPPRAERCRLWMDNRKELT
Ga0316198_10000004413300032251SedimentMMDFGSEQGLSVFATAGIVDYSEDCKKAKTQLWAERCH
Ga0316198_1000517463300032251SedimentMVDFGSEQGLSVLATAGIVGYSEDCKKAKTQLWAERCH
Ga0316198_1001183813300032251SedimentEMVDFGSEQGLSVFATAGIVGYSEDCKKAKTQLWAERCY
Ga0316198_1002895213300032251SedimentMVDFGSEQGLSVFATAGIVNYSEDCKKAKTQLWAER
Ga0316196_1009950413300032252SedimentVHPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPGAERCRLWMDNRKELT
Ga0316191_1001097223300032258Worm BurrowMVDFDSGQGLSDFETGGIACYFEDFKRAKKPPRAERCRLWMDNRKELT
Ga0316194_1013973643300032262SedimentMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLRM
Ga0316194_1096465213300032262SedimentMVDFDSGQGLSDFETRGIVNYFEDFKRAKTQPWIK
Ga0316189_1004223053300032272Worm BurrowMGDFGSEQGLNDFETAGIAGYVEDSKKVKVPFRAKRCRLWM
Ga0316189_1031418813300032272Worm BurrowQGLRNFETAGIAGYFEDFKRANTPPWAERCRLWMGTNK
Ga0316189_1050286723300032272Worm BurrowMGDFGSEQGLSDFETAGIAGYSEDFKRAKTPLWAKRCRLWMGTT
Ga0316189_1089416313300032272Worm BurrowMITFISTLNSVRPQMVDFVSEQGLSDFETAGIVRYVEDLKIAKTPL
Ga0316189_1092625033300032272Worm BurrowMVDFGSGQGLSDFEAGGIACYFEDFKRAKTPLRAERCRLWMETN
Ga0316189_1111962113300032272Worm BurrowMVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAKRCRLWMDTNYVVRRLEQ
Ga0316197_1006434513300032273SedimentEMVDFGSEQGLSVFATAGIVNYSEDFKKAKTHLWAERCH
Ga0316193_1019604633300033429SedimentLSDFETGGVAGYVEDLKRAKTPLRAKRCRLWMGTN
Ga0316193_1123892223300033429SedimentMVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMD
Ga0316193_1132285713300033429SedimentMVDFGPEQGLSDFETGGVAGYVEDLKRAKTPLRAKRCRLWMGTSYQPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.