x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300027021
3300027021: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P2 (1) (SPAdes)
Overview
Basic Information
IMG/M Taxon OID 3300027021 Open in IMG/M GOLD Reference Gs0053056 | Gp0054737 | Ga0207721 Sample Name Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P2 (1) (SPAdes) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 66404535 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico Type Engineered Taxonomy Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
Location Information
Location Bioluminescent Bay, La Paraguera, Puerto Rico Coordinates Lat. (o ) 17.967317 Long. (o ) -67.018833 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F023595 Metagenome / Metatranscriptome 209 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0207721_113179 All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 767 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0207721_113179 Ga0207721_1131792 F023595 MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGTKRCHLWMDTT
