NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026975

3300026975: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026975 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053056 | Gp0054530 | Ga0207799
Sample NameAerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size57625499
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.967317Long. (o)-67.018833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023595Metagenome / Metatranscriptome209Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207799_100010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae388766Open in IMG/M
Ga0207799_100108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria98512Open in IMG/M
Ga0207799_100423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae16870Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207799_100010Ga0207799_100010154F023595MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK
Ga0207799_100108Ga0207799_10010841F023595MYGSPLTSARPEMVDFGFGQGLSDFETAGIVGYFEDFKRAKTPLGSKRCRL
Ga0207799_100423Ga0207799_10042315F023595MVDFGFEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCRF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.