NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026968

3300026968: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026968 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053056 | Gp0054419 | Ga0207831
Sample NameAerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71935382
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.967317Long. (o)-67.018833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023595Metagenome / Metatranscriptome209Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207831_100016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae461429Open in IMG/M
Ga0207831_100023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae385056Open in IMG/M
Ga0207831_100060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae183421Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207831_100016Ga0207831_100016295F023595MVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI
Ga0207831_100023Ga0207831_100023301F023595MVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI
Ga0207831_100060Ga0207831_10006066F023595MVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.