NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F003627

Metagenome / Metatranscriptome Family F003627

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003627
Family Type Metagenome / Metatranscriptome
Number of Sequences 476
Average Sequence Length 37 residues
Representative Sequence VDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ
Number of Associated Samples 325
Number of Associated Scaffolds 476

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.53 %
% of genes near scaffold ends (potentially truncated) 12.39 %
% of genes from short scaffolds (< 2000 bps) 64.29 %
Associated GOLD sequencing projects 293
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.076 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.378 % of family members)
Environment Ontology (ENVO) Unclassified
(41.807 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.017 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.31%    β-sheet: 0.00%    Coil/Unstructured: 47.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 476 Family Scaffolds
PF01040UbiA 27.94
PF00571CBS 22.90
PF02628COX15-CtaA 5.46
PF00115COX1 4.62
PF00034Cytochrom_C 4.41
PF00116COX2 1.68
PF00510COX3 1.47
PF14378PAP2_3 1.05
PF09656PGPGW 0.42
PF00378ECH_1 0.42
PF01061ABC2_membrane 0.42
PF13560HTH_31 0.42
PF02790COX2_TM 0.42
PF02148zf-UBP 0.42
PF13442Cytochrome_CBB3 0.42
PF00958GMP_synt_C 0.21
PF00478IMPDH 0.21
PF11832DUF3352 0.21
PF06463Mob_synth_C 0.21
PF06314ADC 0.21
PF00293NUDIX 0.21
PF02538Hydantoinase_B 0.21
PF10084DUF2322 0.21
PF00380Ribosomal_S9 0.21
PF05977MFS_3 0.21
PF01035DNA_binding_1 0.21
PF02397Bac_transf 0.21
PF07992Pyr_redox_2 0.21
PF03853YjeF_N 0.21
PF05199GMC_oxred_C 0.21
PF02583Trns_repr_metal 0.21
PF01566Nramp 0.21
PF13420Acetyltransf_4 0.21
PF05988DUF899 0.21
PF13692Glyco_trans_1_4 0.21
PF04961FTCD_C 0.21
PF13460NAD_binding_10 0.21
PF03706LPG_synthase_TM 0.21
PF07676PD40 0.21
PF12681Glyoxalase_2 0.21
PF01176eIF-1a 0.21
PF00484Pro_CA 0.21
PF00768Peptidase_S11 0.21
PF00246Peptidase_M14 0.21
PF06570DUF1129 0.21
PF13531SBP_bac_11 0.21
PF00368HMG-CoA_red 0.21
PF12697Abhydrolase_6 0.21
PF07690MFS_1 0.21
PF02401LYTB 0.21
PF02597ThiS 0.21
PF01476LysM 0.21
PF05297Herpes_LMP1 0.21
PF14864Alkyl_sulf_C 0.21
PF00561Abhydrolase_1 0.21

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 476 Family Scaffolds
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 5.46
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 2.10
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 1.68
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 1.47
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 0.42
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 0.42
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.42
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 0.21
COG0103Ribosomal protein S9Translation, ribosomal structure and biogenesis [J] 0.21
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.21
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.21
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.21
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.21
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.21
COG1257Hydroxymethylglutaryl-CoA reductaseLipid transport and metabolism [I] 0.21
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.21
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.21
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.21
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.21
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.21
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.21
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.21
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.21
COG2896GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)Coenzyme transport and metabolism [H] 0.21
COG3404Formiminotetrahydrofolate cyclodeaminaseAmino acid transport and metabolism [E] 0.21
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.21
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.21
COG4689Acetoacetate decarboxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.21
COG4858Uncharacterized membrane-anchored proteinFunction unknown [S] 0.21


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.08 %
UnclassifiedrootN/A35.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908035|B3_GZOS_CLC_ConsensusfromContig110920Not Available711Open in IMG/M
2124908044|A5_c1_ConsensusfromContig12421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1398Open in IMG/M
2140918007|ConsensusfromContig172092Not Available636Open in IMG/M
3300000858|JGI10213J12805_10219582Not Available1123Open in IMG/M
3300000953|JGI11615J12901_14471202Not Available559Open in IMG/M
3300000956|JGI10216J12902_100553435All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300000956|JGI10216J12902_100915295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1395Open in IMG/M
3300000956|JGI10216J12902_104804225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1127Open in IMG/M
3300000956|JGI10216J12902_113275823Not Available512Open in IMG/M
3300000956|JGI10216J12902_114113440Not Available747Open in IMG/M
3300000956|JGI10216J12902_126470761Not Available550Open in IMG/M
3300001405|JGI20186J14852_1001884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1452Open in IMG/M
3300001686|C688J18823_10815282Not Available593Open in IMG/M
3300001977|JGI24746J21847_1000113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9482Open in IMG/M
3300001979|JGI24740J21852_10022756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2152Open in IMG/M
3300002239|JGI24034J26672_10000115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales12949Open in IMG/M
3300003997|Ga0055466_10281911Not Available505Open in IMG/M
3300004001|Ga0055450_10000087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales14428Open in IMG/M
3300004114|Ga0062593_102057149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae636Open in IMG/M
3300004643|Ga0062591_100413180All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300005329|Ga0070683_100521332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300005334|Ga0068869_101497608Not Available599Open in IMG/M
3300005337|Ga0070682_101944814Not Available516Open in IMG/M
3300005344|Ga0070661_100790109All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae778Open in IMG/M
3300005366|Ga0070659_101539916Not Available593Open in IMG/M
3300005458|Ga0070681_10118723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2581Open in IMG/M
3300005526|Ga0073909_10454747Not Available612Open in IMG/M
3300005543|Ga0070672_100000031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia62241Open in IMG/M
3300005548|Ga0070665_100002868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia18629Open in IMG/M
3300005548|Ga0070665_100038076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4835Open in IMG/M
3300005548|Ga0070665_100467901All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300005548|Ga0070665_101210830Not Available766Open in IMG/M
3300005548|Ga0070665_101683816Not Available642Open in IMG/M
3300005563|Ga0068855_101016967Not Available870Open in IMG/M
3300005563|Ga0068855_102139279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005564|Ga0070664_100052530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3453Open in IMG/M
3300005564|Ga0070664_100918918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium821Open in IMG/M
3300005577|Ga0068857_101641337Not Available628Open in IMG/M
3300005578|Ga0068854_100000082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales68340Open in IMG/M
3300005578|Ga0068854_100879972All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005614|Ga0068856_100563038Not Available1161Open in IMG/M
3300005614|Ga0068856_101787964All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae626Open in IMG/M
3300005614|Ga0068856_102642372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300005616|Ga0068852_100000994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia18720Open in IMG/M
3300005616|Ga0068852_101493211All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae698Open in IMG/M
3300005618|Ga0068864_100000090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia96213Open in IMG/M
3300005718|Ga0068866_10000206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales27716Open in IMG/M
3300005718|Ga0068866_10016679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3289Open in IMG/M
3300005764|Ga0066903_108227354Not Available534Open in IMG/M
3300005834|Ga0068851_10003112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7354Open in IMG/M
3300005841|Ga0068863_100121298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2493Open in IMG/M
3300005841|Ga0068863_100533418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1158Open in IMG/M
3300005843|Ga0068860_100085478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3002Open in IMG/M
3300005843|Ga0068860_101774186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300005873|Ga0075287_1030303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300005873|Ga0075287_1037430Not Available644Open in IMG/M
3300005983|Ga0081540_1000557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia36162Open in IMG/M
3300005983|Ga0081540_1217042Not Available683Open in IMG/M
3300006038|Ga0075365_10749302Not Available690Open in IMG/M
3300006175|Ga0070712_100844868Not Available787Open in IMG/M
3300006237|Ga0097621_100917831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei816Open in IMG/M
3300006573|Ga0074055_11833654Not Available715Open in IMG/M
3300006578|Ga0074059_11844374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300006581|Ga0074048_12716516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia678Open in IMG/M
3300006606|Ga0074062_13026934Not Available849Open in IMG/M
3300006640|Ga0075527_10003111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3931Open in IMG/M
3300006640|Ga0075527_10004485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3372Open in IMG/M
3300006642|Ga0075521_10443242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300006755|Ga0079222_10350031Not Available997Open in IMG/M
3300006755|Ga0079222_10378357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300006755|Ga0079222_10810359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei766Open in IMG/M
3300006755|Ga0079222_12077689Not Available561Open in IMG/M
3300006792|Ga0075530_1124152Not Available831Open in IMG/M
3300006804|Ga0079221_11420534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales553Open in IMG/M
3300006845|Ga0075421_100052138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5176Open in IMG/M
3300006846|Ga0075430_100206320Not Available1631Open in IMG/M
3300006853|Ga0075420_100184089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1827Open in IMG/M
3300006854|Ga0075425_100072500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3881Open in IMG/M
3300006854|Ga0075425_100247935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2049Open in IMG/M
3300006854|Ga0075425_100625637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1238Open in IMG/M
3300006876|Ga0079217_11178683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales581Open in IMG/M
3300006881|Ga0068865_101561911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei592Open in IMG/M
3300006904|Ga0075424_100620086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1155Open in IMG/M
3300006953|Ga0074063_12907598Not Available538Open in IMG/M
3300006954|Ga0079219_12122012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales539Open in IMG/M
3300007614|Ga0102946_1000094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia29309Open in IMG/M
3300007614|Ga0102946_1005686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4133Open in IMG/M
3300007757|Ga0102949_1005407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2476Open in IMG/M
3300009011|Ga0105251_10598656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300009093|Ga0105240_11294740Not Available769Open in IMG/M
3300009098|Ga0105245_10038238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4270Open in IMG/M
3300009101|Ga0105247_10000131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales72578Open in IMG/M
3300009112|Ga0115923_10159576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6547Open in IMG/M
3300009147|Ga0114129_12316412Not Available644Open in IMG/M
3300009156|Ga0111538_10654955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1331Open in IMG/M
3300009156|Ga0111538_13978721Not Available511Open in IMG/M
3300009162|Ga0075423_10372678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1498Open in IMG/M
3300009174|Ga0105241_10116429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2146Open in IMG/M
3300009176|Ga0105242_10000428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales33565Open in IMG/M
3300009176|Ga0105242_10632194Not Available1038Open in IMG/M
3300009176|Ga0105242_11293836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300009545|Ga0105237_10257220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1748Open in IMG/M
3300009551|Ga0105238_10000033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia172981Open in IMG/M
3300009551|Ga0105238_10476263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1247Open in IMG/M
3300009553|Ga0105249_10000218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales65480Open in IMG/M
3300009553|Ga0105249_10738102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300009553|Ga0105249_11034453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300009553|Ga0105249_11398991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300009610|Ga0105340_1321008Not Available679Open in IMG/M
3300009789|Ga0126307_10037119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3773Open in IMG/M
3300009789|Ga0126307_10995031Not Available678Open in IMG/M
3300009789|Ga0126307_11708330Not Available512Open in IMG/M
3300009840|Ga0126313_10272624Not Available1317Open in IMG/M
3300009840|Ga0126313_10280002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1300Open in IMG/M
3300009870|Ga0131092_10178996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2263Open in IMG/M
3300009870|Ga0131092_10401499Not Available1276Open in IMG/M
3300010036|Ga0126305_10104745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1705Open in IMG/M
3300010037|Ga0126304_10167226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1429Open in IMG/M
3300010037|Ga0126304_10826320Not Available629Open in IMG/M
3300010039|Ga0126309_10000017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia54762Open in IMG/M
3300010042|Ga0126314_11089025Not Available595Open in IMG/M
3300010043|Ga0126380_10882144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300010044|Ga0126310_11117476Not Available628Open in IMG/M
3300010045|Ga0126311_10003129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8479Open in IMG/M
3300010045|Ga0126311_10139089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1717Open in IMG/M
3300010045|Ga0126311_10258163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300010045|Ga0126311_11323361Not Available599Open in IMG/M
3300010047|Ga0126382_11054215Not Available717Open in IMG/M
3300010051|Ga0133939_1071945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1626Open in IMG/M
3300010166|Ga0126306_10189877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1547Open in IMG/M
3300010166|Ga0126306_10395799All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300010323|Ga0134086_10332047Not Available597Open in IMG/M
3300010359|Ga0126376_11924254Not Available632Open in IMG/M
3300010360|Ga0126372_12488306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300010362|Ga0126377_10310066Not Available1559Open in IMG/M
3300010371|Ga0134125_13049001Not Available508Open in IMG/M
3300010373|Ga0134128_11476005Not Available749Open in IMG/M
3300010373|Ga0134128_12068987Not Available627Open in IMG/M
3300010375|Ga0105239_10487371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300010396|Ga0134126_10033254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6521Open in IMG/M
3300010400|Ga0134122_12927715Not Available531Open in IMG/M
3300010403|Ga0134123_10083601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2495Open in IMG/M
3300010403|Ga0134123_10161789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1865Open in IMG/M
3300011119|Ga0105246_11024624Not Available749Open in IMG/M
3300011418|Ga0153954_1142521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300012014|Ga0120159_1077078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea986Open in IMG/M
3300012039|Ga0137421_1156282Not Available672Open in IMG/M
3300012090|Ga0153956_1001713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales18287Open in IMG/M
3300012201|Ga0137365_10425872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium978Open in IMG/M
3300012212|Ga0150985_100417282Not Available840Open in IMG/M
3300012212|Ga0150985_103669512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300012212|Ga0150985_114396883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria924Open in IMG/M
3300012212|Ga0150985_116019057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea1163Open in IMG/M
3300012212|Ga0150985_120976048Not Available681Open in IMG/M
3300012356|Ga0137371_10012271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter6622Open in IMG/M
3300012469|Ga0150984_104121735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300012469|Ga0150984_105559461Not Available895Open in IMG/M
3300012469|Ga0150984_115982619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300012895|Ga0157309_10305733Not Available538Open in IMG/M
3300012900|Ga0157292_10000006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria118494Open in IMG/M
3300012900|Ga0157292_10068576Not Available994Open in IMG/M
3300012907|Ga0157283_10000825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4369Open in IMG/M
3300012908|Ga0157286_10310134Not Available581Open in IMG/M
3300012909|Ga0157290_10000661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4566Open in IMG/M
3300012913|Ga0157298_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia155123Open in IMG/M
3300012914|Ga0157297_10241968Not Available648Open in IMG/M
3300012915|Ga0157302_10225747Not Available687Open in IMG/M
3300012924|Ga0137413_10259288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M
3300012924|Ga0137413_11804039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012929|Ga0137404_10863096Not Available824Open in IMG/M
3300012939|Ga0162650_100000300All Organisms → cellular organisms → Bacteria4040Open in IMG/M
3300012942|Ga0164242_10362293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1074Open in IMG/M
3300012942|Ga0164242_10612386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300012943|Ga0164241_10001524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales28185Open in IMG/M
3300012943|Ga0164241_10017016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5825Open in IMG/M
3300012943|Ga0164241_10036645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3675Open in IMG/M
3300012944|Ga0137410_11251274Not Available640Open in IMG/M
3300012948|Ga0126375_12047334Not Available507Open in IMG/M
3300012951|Ga0164300_10341729All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300012955|Ga0164298_10163283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1265Open in IMG/M
3300012955|Ga0164298_10723404Not Available701Open in IMG/M
3300012955|Ga0164298_11420056Not Available538Open in IMG/M
3300012955|Ga0164298_11638586Not Available508Open in IMG/M
3300012957|Ga0164303_11096338Not Available574Open in IMG/M
3300012958|Ga0164299_10022671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2604Open in IMG/M
3300012958|Ga0164299_10706124Not Available706Open in IMG/M
3300012958|Ga0164299_11237354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae567Open in IMG/M
3300012985|Ga0164308_10605455Not Available933Open in IMG/M
3300012985|Ga0164308_11660472Not Available592Open in IMG/M
3300012986|Ga0164304_11099355Not Available636Open in IMG/M
3300012987|Ga0164307_10034647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2768Open in IMG/M
3300012987|Ga0164307_10607999Not Available844Open in IMG/M
3300012987|Ga0164307_10968412All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae690Open in IMG/M
3300012989|Ga0164305_11221080Not Available653Open in IMG/M
3300013104|Ga0157370_10126005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2390Open in IMG/M
3300013297|Ga0157378_10016178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6532Open in IMG/M
3300013297|Ga0157378_10149338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2176Open in IMG/M
3300013297|Ga0157378_11046379Not Available852Open in IMG/M
3300013306|Ga0163162_11217687Not Available855Open in IMG/M
3300013308|Ga0157375_10009414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8576Open in IMG/M
3300013308|Ga0157375_12514616All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300013308|Ga0157375_12954415Not Available568Open in IMG/M
3300013772|Ga0120158_10310750Not Available758Open in IMG/M
3300014254|Ga0075312_1128446Not Available547Open in IMG/M
3300014254|Ga0075312_1134643Not Available538Open in IMG/M
3300014255|Ga0075320_1034971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288864Open in IMG/M
3300014259|Ga0075311_1023598Not Available1111Open in IMG/M
3300014263|Ga0075324_1000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales192656Open in IMG/M
3300014267|Ga0075313_1207304Not Available522Open in IMG/M
3300014270|Ga0075325_1000062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales13504Open in IMG/M
3300014270|Ga0075325_1015108Not Available1396Open in IMG/M
3300014270|Ga0075325_1104796Not Available671Open in IMG/M
3300014271|Ga0075326_1259371Not Available536Open in IMG/M
3300014299|Ga0075303_1003019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1846Open in IMG/M
3300014300|Ga0075321_1069177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300014301|Ga0075323_1121038Not Available579Open in IMG/M
3300014311|Ga0075322_1000344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album6104Open in IMG/M
3300014314|Ga0075316_1021065Not Available1274Open in IMG/M
3300014325|Ga0163163_10278387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1724Open in IMG/M
3300014325|Ga0163163_10289046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1691Open in IMG/M
3300014325|Ga0163163_11593631Not Available714Open in IMG/M
3300014326|Ga0157380_10001343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia16023Open in IMG/M
3300014487|Ga0182000_10008400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2435Open in IMG/M
3300014498|Ga0182019_10103938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1742Open in IMG/M
3300014745|Ga0157377_10206552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1250Open in IMG/M
3300014968|Ga0157379_10088527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2777Open in IMG/M
3300014968|Ga0157379_10712100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300014969|Ga0157376_10078125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2833Open in IMG/M
3300015069|Ga0167633_114515Not Available918Open in IMG/M
3300015085|Ga0167632_1021861Not Available873Open in IMG/M
3300015089|Ga0167643_1031121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300015090|Ga0167634_1003610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2059Open in IMG/M
3300015200|Ga0173480_10931117Not Available567Open in IMG/M
3300015242|Ga0137412_10962701Not Available614Open in IMG/M
3300015242|Ga0137412_11038831Not Available584Open in IMG/M
3300015371|Ga0132258_11061157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2048Open in IMG/M
3300017792|Ga0163161_10008446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7130Open in IMG/M
3300017930|Ga0187825_10125359Not Available898Open in IMG/M
3300017965|Ga0190266_10074556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1303Open in IMG/M
3300018067|Ga0184611_1217818Not Available679Open in IMG/M
3300018071|Ga0184618_10159215Not Available927Open in IMG/M
3300018422|Ga0190265_10000063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia122964Open in IMG/M
3300018422|Ga0190265_10054813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3503Open in IMG/M
3300018422|Ga0190265_10087103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2880Open in IMG/M
3300018422|Ga0190265_10148450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2289Open in IMG/M
3300018429|Ga0190272_10011078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4432Open in IMG/M
3300018429|Ga0190272_10147731Not Available1612Open in IMG/M
3300018429|Ga0190272_10252473Not Available1325Open in IMG/M
3300018429|Ga0190272_10387094Not Available1134Open in IMG/M
3300018431|Ga0066655_10163967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1335Open in IMG/M
3300018432|Ga0190275_10000304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales47598Open in IMG/M
3300018432|Ga0190275_10003499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11225Open in IMG/M
3300018432|Ga0190275_11300242Not Available803Open in IMG/M
3300018432|Ga0190275_11758871Not Available698Open in IMG/M
3300018432|Ga0190275_12009533Not Available657Open in IMG/M
3300018465|Ga0190269_10001067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia13332Open in IMG/M
3300018466|Ga0190268_10225737Not Available1050Open in IMG/M
3300018469|Ga0190270_10026236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3709Open in IMG/M
3300018469|Ga0190270_10071919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2521Open in IMG/M
3300018469|Ga0190270_10560405Not Available1104Open in IMG/M
3300018469|Ga0190270_10938055Not Available887Open in IMG/M
3300018469|Ga0190270_12033886Not Available633Open in IMG/M
3300018476|Ga0190274_10000037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia126925Open in IMG/M
3300018476|Ga0190274_10000647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20387Open in IMG/M
3300018476|Ga0190274_10065204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2719Open in IMG/M
3300018476|Ga0190274_10279527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1537Open in IMG/M
3300018481|Ga0190271_10000013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia178071Open in IMG/M
3300018481|Ga0190271_10000157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales34663Open in IMG/M
3300018481|Ga0190271_10023657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4803Open in IMG/M
3300018481|Ga0190271_10037326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4000Open in IMG/M
3300018481|Ga0190271_10912305Not Available1003Open in IMG/M
3300018920|Ga0190273_10000018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia124864Open in IMG/M
3300018920|Ga0190273_10212013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1222Open in IMG/M
3300018920|Ga0190273_10497074Not Available891Open in IMG/M
3300018920|Ga0190273_11385435Not Available613Open in IMG/M
3300019377|Ga0190264_10250996Not Available1026Open in IMG/M
3300019377|Ga0190264_10614910Not Available779Open in IMG/M
3300019875|Ga0193701_1100403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300019881|Ga0193707_1088164All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae942Open in IMG/M
3300019884|Ga0193741_1016487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1903Open in IMG/M
3300019889|Ga0193743_1001890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia15113Open in IMG/M
3300020005|Ga0193697_1069486Not Available865Open in IMG/M
3300020020|Ga0193738_1034477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300020021|Ga0193726_1047600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2057Open in IMG/M
3300020021|Ga0193726_1050477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1985Open in IMG/M
3300020022|Ga0193733_1102360Not Available799Open in IMG/M
3300020034|Ga0193753_10076177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1723Open in IMG/M
3300020034|Ga0193753_10116183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1314Open in IMG/M
3300020059|Ga0193745_1024786Not Available1315Open in IMG/M
3300020069|Ga0197907_10870875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria907Open in IMG/M
3300020070|Ga0206356_10666627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2422Open in IMG/M
3300020077|Ga0206351_10408391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1040Open in IMG/M
3300020154|Ga0196965_1166214Not Available571Open in IMG/M
3300020181|Ga0196958_10002198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5976Open in IMG/M
3300020181|Ga0196958_10143598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae820Open in IMG/M
3300020181|Ga0196958_10212246Not Available692Open in IMG/M
3300020610|Ga0154015_1540969Not Available806Open in IMG/M
3300021086|Ga0179596_10638289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300021339|Ga0193706_1007093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4093Open in IMG/M
3300021339|Ga0193706_1012390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2868Open in IMG/M
3300021339|Ga0193706_1053022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300021363|Ga0193699_10119504Not Available1073Open in IMG/M
3300021401|Ga0210393_10295700Not Available1315Open in IMG/M
3300021403|Ga0210397_10085566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2099Open in IMG/M
3300021412|Ga0193736_1057987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300021445|Ga0182009_10641761Not Available571Open in IMG/M
3300021559|Ga0210409_10010053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9545Open in IMG/M
3300021560|Ga0126371_10936224All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300022756|Ga0222622_10049022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2374Open in IMG/M
3300022756|Ga0222622_10603769Not Available792Open in IMG/M
3300022880|Ga0247792_1011158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1384Open in IMG/M
3300022899|Ga0247795_1000128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11829Open in IMG/M
3300022910|Ga0247768_1000016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria168636Open in IMG/M
3300023067|Ga0247743_1002044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2237Open in IMG/M
3300023102|Ga0247754_1000752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5124Open in IMG/M
3300023265|Ga0247780_1001443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia13674Open in IMG/M
3300023266|Ga0247789_1010551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1448Open in IMG/M
3300023266|Ga0247789_1056555Not Available730Open in IMG/M
3300023268|Ga0247765_1005325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3623Open in IMG/M
3300023275|Ga0247776_10000281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11878Open in IMG/M
3300024055|Ga0247794_10063550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1037Open in IMG/M
3300024347|Ga0179591_1180883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2787Open in IMG/M
3300024426|Ga0196960_10000579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12006Open in IMG/M
3300024426|Ga0196960_10063785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1050Open in IMG/M
3300024430|Ga0196962_10000259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia25574Open in IMG/M
3300024996|Ga0209916_1000951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales33149Open in IMG/M
3300025321|Ga0207656_10017412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album2815Open in IMG/M
3300025504|Ga0208356_1000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia131014Open in IMG/M
3300025535|Ga0207423_1009837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1471Open in IMG/M
3300025538|Ga0210132_1000139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9952Open in IMG/M
3300025552|Ga0210142_1006585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2107Open in IMG/M
3300025565|Ga0210110_1002650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5140Open in IMG/M
3300025565|Ga0210110_1010855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2429Open in IMG/M
3300025568|Ga0210095_1017120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1654Open in IMG/M
3300025571|Ga0207874_1060801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium876Open in IMG/M
3300025583|Ga0210085_1000593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia15027Open in IMG/M
3300025593|Ga0210096_1198200Not Available558Open in IMG/M
3300025615|Ga0210086_1013182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2985Open in IMG/M
3300025615|Ga0210086_1101045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea856Open in IMG/M
3300025625|Ga0208219_1003138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5777Open in IMG/M
3300025634|Ga0208589_1100834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300025780|Ga0210100_1000230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9368Open in IMG/M
3300025780|Ga0210100_1000251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8607Open in IMG/M
3300025798|Ga0210063_1000059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia35806Open in IMG/M
3300025799|Ga0210122_1009057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi2730Open in IMG/M
3300025814|Ga0210101_1000196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia22236Open in IMG/M
3300025814|Ga0210101_1000339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia16253Open in IMG/M
3300025814|Ga0210101_1104764Not Available741Open in IMG/M
3300025817|Ga0210144_1000148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia40255Open in IMG/M
3300025817|Ga0210144_1000280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales29393Open in IMG/M
3300025817|Ga0210144_1129479Not Available726Open in IMG/M
3300025823|Ga0210123_1049813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1371Open in IMG/M
3300025823|Ga0210123_1122426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300025854|Ga0209176_10016780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1478Open in IMG/M
3300025878|Ga0209584_10277228Not Available643Open in IMG/M
3300025898|Ga0207692_10126787Not Available1437Open in IMG/M
3300025899|Ga0207642_10000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia401934Open in IMG/M
3300025899|Ga0207642_10000737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia10119Open in IMG/M
3300025899|Ga0207642_10019348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2635Open in IMG/M
3300025905|Ga0207685_10000012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia189900Open in IMG/M
3300025906|Ga0207699_11133220Not Available579Open in IMG/M
3300025908|Ga0207643_10663734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae673Open in IMG/M
3300025911|Ga0207654_10650429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300025912|Ga0207707_10059817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3315Open in IMG/M
3300025912|Ga0207707_11095448Not Available649Open in IMG/M
3300025915|Ga0207693_10010825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7404Open in IMG/M
3300025915|Ga0207693_11212994Not Available568Open in IMG/M
3300025919|Ga0207657_10166653Not Available1787Open in IMG/M
3300025924|Ga0207694_10000012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia411218Open in IMG/M
3300025924|Ga0207694_10496541Not Available1022Open in IMG/M
3300025926|Ga0207659_10000055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia74252Open in IMG/M
3300025927|Ga0207687_10020955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4339Open in IMG/M
3300025928|Ga0207700_10000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia500797Open in IMG/M
3300025929|Ga0207664_10015535All Organisms → cellular organisms → Bacteria5529Open in IMG/M
3300025934|Ga0207686_10339430Not Available1128Open in IMG/M
3300025937|Ga0207669_10107293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1862Open in IMG/M
3300025938|Ga0207704_10245347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91341Open in IMG/M
3300025938|Ga0207704_11253647All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae633Open in IMG/M
3300025939|Ga0207665_11437424Not Available549Open in IMG/M
3300025946|Ga0210126_100464All Organisms → cellular organisms → Bacteria3202Open in IMG/M
3300025949|Ga0207667_10617093Not Available1092Open in IMG/M
3300025949|Ga0207667_10700316Not Available1015Open in IMG/M
3300025961|Ga0207712_10000027All Organisms → cellular organisms → Bacteria263739Open in IMG/M
3300025961|Ga0207712_11045290Not Available726Open in IMG/M
3300025961|Ga0207712_11213984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300025986|Ga0207658_10103947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2231Open in IMG/M
3300025986|Ga0207658_10486284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1097Open in IMG/M
3300025986|Ga0207658_10532709Not Available1049Open in IMG/M
3300025996|Ga0208777_1010761Not Available775Open in IMG/M
3300025996|Ga0208777_1013266All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae699Open in IMG/M
3300026023|Ga0207677_10003648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8170Open in IMG/M
3300026023|Ga0207677_10009001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5602Open in IMG/M
3300026051|Ga0208911_1000261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4107Open in IMG/M
3300026051|Ga0208911_1004916Not Available1204Open in IMG/M
3300026058|Ga0208421_1018676Not Available626Open in IMG/M
3300026066|Ga0208290_1000039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5761Open in IMG/M
3300026067|Ga0207678_10118785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2256Open in IMG/M
3300026067|Ga0207678_10347112All Organisms → cellular organisms → Bacteria → Proteobacteria1280Open in IMG/M
3300026075|Ga0207708_10524947Not Available995Open in IMG/M
3300026088|Ga0207641_10076027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2902Open in IMG/M
3300026095|Ga0207676_10000016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia311561Open in IMG/M
3300026107|Ga0209950_1005058Not Available1410Open in IMG/M
3300026121|Ga0207683_10196742All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300026142|Ga0207698_11593350All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300026142|Ga0207698_11721077All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae642Open in IMG/M
3300026142|Ga0207698_12265682Not Available555Open in IMG/M
3300027524|Ga0208998_1000008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia116202Open in IMG/M
3300027636|Ga0214469_1002897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album6389Open in IMG/M
3300027636|Ga0214469_1145766Not Available670Open in IMG/M
3300027725|Ga0209178_1358226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300027787|Ga0209074_10447444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300027909|Ga0209382_10023534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei7459Open in IMG/M
3300028293|Ga0247662_1064979Not Available644Open in IMG/M
3300028379|Ga0268266_10015588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6515Open in IMG/M
3300028379|Ga0268266_11199042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300028380|Ga0268265_12430781Not Available530Open in IMG/M
3300028381|Ga0268264_10001191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales25160Open in IMG/M
3300028381|Ga0268264_12137917Not Available568Open in IMG/M
3300028556|Ga0265337_1001256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12773Open in IMG/M
3300028556|Ga0265337_1199593Not Available543Open in IMG/M
3300028558|Ga0265326_10156483Not Available651Open in IMG/M
3300028712|Ga0307285_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria246966Open in IMG/M
3300028714|Ga0307309_10056196Not Available867Open in IMG/M
3300028721|Ga0307315_10057660Not Available1091Open in IMG/M
3300028768|Ga0307280_10000024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales47053Open in IMG/M
3300028768|Ga0307280_10252238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae635Open in IMG/M
3300028768|Ga0307280_10260103Not Available626Open in IMG/M
3300028782|Ga0307306_10000044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia25664Open in IMG/M
3300028802|Ga0307503_10000132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia35030Open in IMG/M
3300028802|Ga0307503_10629734Not Available595Open in IMG/M
3300028875|Ga0307289_10035626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1970Open in IMG/M
3300029987|Ga0311334_11820946Not Available519Open in IMG/M
3300030006|Ga0299907_10203087Not Available1635Open in IMG/M
3300030499|Ga0268259_10092395Not Available668Open in IMG/M
3300030510|Ga0268243_1006865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2026Open in IMG/M
3300031184|Ga0307499_10005236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2673Open in IMG/M
3300031226|Ga0307497_10489173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae605Open in IMG/M
3300031228|Ga0299914_10000191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales36365Open in IMG/M
3300031228|Ga0299914_10010643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales7051Open in IMG/M
3300031229|Ga0299913_10093294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2933Open in IMG/M
3300031274|Ga0307442_1132132Not Available709Open in IMG/M
3300031367|Ga0307440_1007722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4139Open in IMG/M
3300031367|Ga0307440_1143474Not Available664Open in IMG/M
3300031411|Ga0102761_12173612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031740|Ga0307468_101028947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300031873|Ga0315297_10354097Not Available1229Open in IMG/M
3300031938|Ga0308175_100000371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia31471Open in IMG/M
3300031996|Ga0308176_10487991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1248Open in IMG/M
3300032002|Ga0307416_103064029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae559Open in IMG/M
3300032074|Ga0308173_11852421Not Available569Open in IMG/M
3300032080|Ga0326721_10000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria96017Open in IMG/M
3300032126|Ga0307415_100649460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia945Open in IMG/M
3300032157|Ga0315912_11201659Not Available601Open in IMG/M
3300032174|Ga0307470_10008781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4095Open in IMG/M
3300032174|Ga0307470_11080195Not Available644Open in IMG/M
3300032180|Ga0307471_100178776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2090Open in IMG/M
3300032205|Ga0307472_101189987Not Available727Open in IMG/M
3300032205|Ga0307472_101428365Not Available672Open in IMG/M
3300032829|Ga0335070_10000099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia97495Open in IMG/M
3300032829|Ga0335070_10109147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2881Open in IMG/M
3300032829|Ga0335070_10190739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2048Open in IMG/M
3300032829|Ga0335070_10238497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1789Open in IMG/M
3300032896|Ga0335075_10466718Not Available1307Open in IMG/M
3300032896|Ga0335075_11293618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300032954|Ga0335083_10000084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia167442Open in IMG/M
3300032954|Ga0335083_11336632Not Available550Open in IMG/M
3300033433|Ga0326726_10028034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4900Open in IMG/M
3300034125|Ga0370484_0042838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB5112881107Open in IMG/M
3300034128|Ga0370490_0174418Not Available705Open in IMG/M
3300034147|Ga0364925_0018486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2196Open in IMG/M
3300034402|Ga0334960_000648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12916Open in IMG/M
3300034687|Ga0334905_000287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7295Open in IMG/M
3300034690|Ga0364923_0014158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1759Open in IMG/M
3300034781|Ga0334935_102643Not Available781Open in IMG/M
3300034965|Ga0370497_0055924Not Available881Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.38%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.25%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.10%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.05%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.05%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.05%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.84%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.63%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.63%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.42%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.42%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.42%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.42%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.42%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.21%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.21%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.21%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.21%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.21%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.21%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.21%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.21%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.21%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.21%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.21%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.21%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.21%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.21%
Industrial WastewaterEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater0.21%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.21%
Swimming Pool Sandfilter BackwashEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash0.21%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.21%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908035Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001405Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004001Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006792Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-DEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007614Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MGEnvironmentalOpen in IMG/M
3300007757Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MGEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009112Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2EngineeredOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010051Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196EngineeredOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011418Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaGHost-AssociatedOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012090Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaGHost-AssociatedOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012942Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015069Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lakeEnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015090Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020154Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20EnvironmentalOpen in IMG/M
3300020181Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022910Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300024426Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5EnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300024996Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_2 (SPAdes)EngineeredOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025568Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025571Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes)EngineeredOpen in IMG/M
3300025583Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025593Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025615Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025798Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025799Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025814Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025817Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025823Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025946Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025996Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026058Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026107Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031274Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30EnvironmentalOpen in IMG/M
3300031367Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10EnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034402Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNSEnvironmentalOpen in IMG/M
3300034687Soil microbial communities from Mojave Desert, California, United States - 1NOCEnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M
3300034781Biocrust microbial communities from Mojave Desert, California, United States - 31SMCEnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_GZOS_CLC_022193702124908035SoilVDRETARKNMTSGLIAGGFAAAIFALSFVVAFLYIAQ
A5_c1_006774102124908044SoilVDRETARKNMSAGLFAGAVAATIFALSFVAAFLYIAQ
A_all_C_031873102140918007SoilVDRETARRNMIGGLMAGGFAAAIFALSFVVALLYIAQ
JGI10213J12805_1021958223300000858SoilMDRETSRANVSAGLVAGGIAAAVFALCFVAAVLYIAS*
JGI11615J12901_1447120223300000953SoilVDRETARSSISAGLLAGGIAAAVFALSFVAAVLYIAS*
JGI10216J12902_10055343543300000956SoilMDRESSRQSIRAGLVAGGFAAGVFALCFVAAFLYIAQ*
JGI10216J12902_10091529543300000956SoilVDRETYRRDLRAGLVAGGVAAAIFAICFVVATLYIAS*
JGI10216J12902_10480422533300000956SoilMDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ*
JGI10216J12902_11327582323300000956SoilMDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ*
JGI10216J12902_11411344023300000956SoilMDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ*
JGI10216J12902_12647076123300000956SoilMDRENARRQISAGLVTGGIAAGVFALSFIAAFLYIAQ*
JGI20186J14852_100188423300001405Arctic Peat SoilMDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ*
C688J18823_1081528223300001686SoilVDRETARGNMSAGLVAGGIAAAIFALCFVAAMLYIAS*
JGI24746J21847_1000113153300001977Corn, Switchgrass And Miscanthus RhizospherePAVDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS*
JGI24740J21852_1002275653300001979Corn RhizosphereVDRETARKNMAAGLVAAGFATAIFALTFVAALLYIAQG*
JGI24034J26672_1000011523300002239Corn, Switchgrass And Miscanthus RhizosphereVDRETARRDIGAGLLAAGIAASVFALCFVAAMLYIAS*
Ga0055466_1028191123300003997Natural And Restored WetlandsDRTPAVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS*
Ga0055450_1000008783300004001Natural And Restored WetlandsLIEIQAMDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS*
Ga0062593_10205714933300004114SoilPRSLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0062591_10041318013300004643SoilPPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0070683_10052133213300005329Corn RhizosphereSLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068869_10149760823300005334Miscanthus RhizosphereVLMDREQARKNMVGGLVAGGFATAIFALAFVAAFLYIAQS*
Ga0070682_10194481413300005337Corn RhizosphereDRNPAVDRETARKNMSAGLVAGGLAATVFALCFVAAFLYIAQ*
Ga0070661_10079010913300005344Corn RhizosphereRSSGRNPPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0070659_10153991623300005366Corn RhizosphereRNPPVDRESARSSISAGLLAGGVAAAVFALSFVVAVLYVAS*
Ga0070681_1011872353300005458Corn RhizosphereGHPPALEAARTDRNPAVDRETARRSMTAGMVAGGFAAVVFALCFIVALLYIAHG*
Ga0073909_1045474723300005526Surface SoilMDRETARRDMTAGLLAGGIAAAVFALCFVAAMLYIASA*
Ga0070672_100000031583300005543Miscanthus RhizosphereMDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0070665_100002868113300005548Switchgrass RhizosphereMDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0070665_10003807633300005548Switchgrass RhizosphereMDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA*
Ga0070665_10046790123300005548Switchgrass RhizosphereVDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYVGAA*
Ga0070665_10121083013300005548Switchgrass RhizosphereMDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAGS*
Ga0070665_10168381623300005548Switchgrass RhizosphereVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH*
Ga0068855_10101696723300005563Corn RhizosphereVDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS*
Ga0068855_10213927913300005563Corn RhizosphereVDRETARRSMTAGLVAGGFAAAVFAACFIVALLYIAH*
Ga0070664_10005253043300005564Corn RhizosphereMDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0070664_10091891813300005564Corn RhizosphereVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0068857_10164133713300005577Corn RhizosphereMDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068854_100000082593300005578Corn RhizosphereMDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068854_10087997223300005578Corn RhizosphereMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068856_10056303823300005614Corn RhizosphereVDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS*
Ga0068856_10178796433300005614Corn RhizosphereVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068856_10264237223300005614Corn RhizosphereVDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG*
Ga0068852_10000099453300005616Corn RhizosphereMDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068852_10149321133300005616Corn RhizosphereMDRQTGKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068864_100000090753300005618Switchgrass RhizosphereVDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS*
Ga0068866_1000020663300005718Miscanthus RhizosphereMDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS*
Ga0068866_1001667933300005718Miscanthus RhizosphereMDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0066903_10822735423300005764Tropical Forest SoilVDRETAKANMTAGLIAGGIAAAVFALTFVIAVLYIAS*
Ga0068851_1000311243300005834Corn RhizosphereMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG*
Ga0068863_10012129823300005841Switchgrass RhizosphereVDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0068863_10053341813300005841Switchgrass RhizosphereVDRESAKRNIGAGLVAGGIAAGVFALSFVVAVLYI
Ga0068860_10008547853300005843Switchgrass RhizosphereVDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS*
Ga0068860_10177418623300005843Switchgrass RhizosphereVDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS*
Ga0075287_103030323300005873Rice Paddy SoilVDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS*
Ga0075287_103743023300005873Rice Paddy SoilVDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS*
Ga0081540_1000557333300005983Tabebuia Heterophylla RhizosphereMDRESARNNMVGGLVAGGFAAAIFALAFVAAALYLATS*
Ga0081540_121704223300005983Tabebuia Heterophylla RhizosphereMDRESARANMSAGLVAGGIAAAVFALCFVAAMLYIAS*
Ga0075365_1074930223300006038Populus EndosphereVDRERARSNIGAGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0070712_10084486833300006175Corn, Switchgrass And Miscanthus RhizosphereMDRETARRNITGGLVAGGFAAAIFALSFVVALLYIAQ*
Ga0097621_10091783113300006237Miscanthus RhizosphereMDREIARKNMGSGLVAGGLAAFVFALCFVAAFLYIAQ*
Ga0074055_1183365423300006573SoilMDRETARRDVAAGLLAGGIAAAVFALCFVAAMLYIAS*
Ga0074059_1184437423300006578SoilVDRETARKNMSAGLVAGGFAAAVFALSFVAAFLYIAQ*
Ga0074048_1271651633300006581SoilVDRETARKNMSAGLAAGGLAAAVFALAFVAAFLYIAQ*
Ga0074062_1302693423300006606SoilVDRETARAKMSAGLLAGGIAAAIFSLCFVAATLYVAS*
Ga0075527_1000311143300006640Arctic Peat SoilVDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS*
Ga0075527_1000448533300006640Arctic Peat SoilVDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS*
Ga0075521_1044324223300006642Arctic Peat SoilVDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ*
Ga0079222_1035003133300006755Agricultural SoilSRNLAVDRETARANMTAGLVAGGIAAAVVALCFVVAMLYVAS*
Ga0079222_1037835723300006755Agricultural SoilMDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ*
Ga0079222_1081035913300006755Agricultural SoilMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAQ*
Ga0079222_1207768923300006755Agricultural SoilMDRESARQSMKAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0075530_112415213300006792Arctic Peat SoilTVDRETSRRDMRAGLLAGGTAAAVFALCFVAAMLYIAS*
Ga0079221_1142053423300006804Agricultural SoilMDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0075421_10005213853300006845Populus RhizosphereVDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0075430_10020632043300006846Populus RhizosphereVDRKTSRANISAGLLAGGIGAAIFALCFVAAVLYIAS*
Ga0075420_10018408933300006853Populus RhizosphereVDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG*
Ga0075425_10007250023300006854Populus RhizosphereVDRESARKNMSGGLLLGGFATAIFALSFVAAFLYIAGA*
Ga0075425_10024793553300006854Populus RhizospherePVDRESARANMSAGLLAGGIATAVFALCFVAAMLYIAS*
Ga0075425_10062563733300006854Populus RhizosphereVDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0079217_1117868323300006876Agricultural SoilVDRESARRNLSTGFLVGAIAAGVFALSFVAAMLYIAS*
Ga0068865_10156191133300006881Miscanthus RhizosphereMDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA*
Ga0068865_10207783723300006881Miscanthus RhizosphereGPPDRNPAVDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0075424_10062008623300006904Populus RhizosphereMDRETARRNMRAGLFAGGIAAGIFALSFVAAFLYIAQ*
Ga0074063_1290759813300006953SoilMDRESARKNMAAGLVAGGFAAAVFALCFVAAFLYI
Ga0079219_1212201233300006954Agricultural SoilGLMDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0102946_1000094103300007614SoilVDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA*
Ga0102946_100568673300007614SoilVDRETSRRDIRAGLLAGGIAATVFGLSFVAAMLYIAS*
Ga0102949_100540743300007757SoilVDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS*
Ga0105251_1059865613300009011Switchgrass RhizosphereVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105240_1129474023300009093Corn RhizosphereVDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0105245_1003823823300009098Miscanthus RhizosphereMDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ*
Ga0105247_10000131453300009101Switchgrass RhizosphereVDRESARKNMTAGLVAAGFATGIFALTFVAALFYIAQG*
Ga0115923_1015957643300009112Swimming Pool Sandfilter BackwashVDRETARKNMSAGLVAGGFATAVFALAFVAAFLYIAQG*
Ga0114129_1231641223300009147Populus RhizosphereVDREQARKNVGAGLMLGAFAAAIFALSFVAALLYIAQ*
Ga0111538_1065495543300009156Populus RhizosphereDRNRFVDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0111538_1397872123300009156Populus RhizosphereMDRETARRQMRAGLVAGGIAAGIFALSLVAAFLYIAQ*
Ga0075423_1037267823300009162Populus RhizosphereVDRETSRRDLKAGLLAGGFAAAVFALCFVAATLYIAS*
Ga0105241_1011642953300009174Corn RhizosphereMDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0105242_10000428333300009176Miscanthus RhizosphereVDRETARKNMTAGLVAAGLATGIFALTFVAALFYIAQG*
Ga0105242_1063219423300009176Miscanthus RhizosphereVDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH*
Ga0105242_1129383633300009176Miscanthus RhizosphereAVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAHG*
Ga0105237_1025722033300009545Corn RhizosphereMDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH*
Ga0105238_100000331263300009551Corn RhizosphereMDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS*
Ga0105238_1047626343300009551Corn RhizosphereMDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105249_10000218373300009553Switchgrass RhizosphereVDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS*
Ga0105249_1073810223300009553Switchgrass RhizosphereVDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0105249_1103445313300009553Switchgrass RhizosphereTARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0105249_1139899113300009553Switchgrass RhizosphereANRGAARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105340_132100823300009610SoilVDRETTKRSITAGLMAGGVAAAIFALSFVVAMLYIAA*
Ga0126307_1003711933300009789Serpentine SoilVDRETARRSISTGLLAGGIAAAVFALTFVAAVLYIAS*
Ga0126307_1099503123300009789Serpentine SoilVDRESARRNIATGLLAGAIAASVFALSFVAAVLYIAS*
Ga0126307_1170833013300009789Serpentine SoilVDRESARRNIASGLLAGAVAAGVFALAFVAAVLYIAS*
Ga0126313_1027262433300009840Serpentine SoilVDRETARRSISTGLLAGGIAAAVFALTFVVAVLYIAS*
Ga0126313_1028000233300009840Serpentine SoilMDRETARKNMGAGLVAGGFAAAIFALCFVAAFLYIAQ*
Ga0131092_1017899633300009870Activated SludgeMDRETERRSIGGGLVIGAIAAAMFALAFLAAMLYIAP*
Ga0131092_1040149923300009870Activated SludgeMDRESAKQSIGGGLVIGAIAAAMFALAFLAAMLYIAP*
Ga0126305_1010474523300010036Serpentine SoilMDRESARRQLRAGLVTGGIAAGIFALSFVAAFLYIAQ*
Ga0126304_1016722633300010037Serpentine SoilMDRDTARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0126304_1082632023300010037Serpentine SoilVDRETARSSVSAGLLAGGIAAAVFALSFLAAVLYIAS*
Ga0126309_10000017423300010039Serpentine SoilVDREHARRNLGQGLILGVVAAGIFALSFFAAMIYIAA*
Ga0126314_1108902513300010042Serpentine SoilGRNPAVDREDARRNIATGLLAGAIAASVFALSFVVAILYIAS*
Ga0126380_1088214413300010043Tropical Forest SoilHPVDRETARRNMSAGLVAGGFAAMIFALCFIVALLYIAH*
Ga0126310_1111747623300010044Serpentine SoilVDRETARRNLSAGLLYGGIAAAVFALCFIASILYIA*
Ga0126311_1000312983300010045Serpentine SoilVDREDARRNIATGLLAGAIAASVFALSFVVAVLYIAS*
Ga0126311_1013908923300010045Serpentine SoilVDRENARRNIVSGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0126311_1025816323300010045Serpentine SoilVDRETSRKNMSAGLVAGGFAAAIFALCFVAAFLYIAQA*
Ga0126311_1132336123300010045Serpentine SoilMDRESARRNISTGLLAGGIAAAIFALSFVAAVLYIAS*
Ga0126382_1105421533300010047Tropical Forest SoilVDRDLAKKNMSAGLVAGGIAAAVFALTFVAAVLYIAS*
Ga0133939_107194533300010051Industrial WastewaterVDRESARANLISGLVTGGLAALVFALCFVAAALYLATQ*
Ga0126306_1018987723300010166Serpentine SoilMDRETARRNVKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0126306_1039579933300010166Serpentine SoilMDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0134086_1033204723300010323Grasslands SoilVDRDTARAGISAGLLAGGIAAAVFALSFVAAVLYIAS*
Ga0126376_1192425413300010359Tropical Forest SoilVDRESARKNMSAGLVAGGLATGVFALCFVTALLYIAA*
Ga0126372_1248830623300010360Tropical Forest SoilVDRETARRNMTAGLVAGGFAASVFALCFIVALLYIAH*
Ga0126377_1031006633300010362Tropical Forest SoilMDRETARANMGAGLLAGGIAATVFALCFVVAMLYVAS*
Ga0134125_1304900113300010371Terrestrial SoilKSHFMDREVARKNMSSGLVAGGLAAAVFALCFIAAFLYIAQ*
Ga0134128_1147600523300010373Terrestrial SoilVDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS*
Ga0134128_1206898723300010373Terrestrial SoilVDRELARRNMKGGLLAGGIAVAVFALSFVAAMLYIAS*
Ga0105239_1048737123300010375Corn RhizosphereMDRETARKNMSAGLVAGGFAAAIFALSFVVAFLYIAQ*
Ga0134126_1003325453300010396Terrestrial SoilVDRETARRNMTAGLVAGGFAAMIFALCFIVALLYIAH*
Ga0134122_1292771533300010400Terrestrial SoilMDRETAKANMTAGLVAGGIAAGIFALTFVVAVLYIAS*
Ga0134123_1008360153300010403Terrestrial SoilVDREASRASIAAGLTAGGIVAAIFALCFVAAVLYIAS*
Ga0134123_1016178943300010403Terrestrial SoilVDRETARAKMSAGLVAGGIAAAVFALCFVAAMLYVAS*
Ga0105246_1102462423300011119Miscanthus RhizosphereVDRERARSNIATGLLAGAIAAGIFALTFVVAVLYIAS*
Ga0153954_114252113300011418Attine Ant Fungus GardensKTGETDRNPPVDRETARRNMTAGLIAGGFSAVVFALCFIVALLWIAH*
Ga0120159_107707833300012014PermafrostVDRETARRNMSAALVAGGFAAAIFALAFVVALLYIAQ*
Ga0137421_115628223300012039SoilVDRETSRRDIAAGLLAGGIAAGVFALCFLAAMLYIAS*
Ga0153956_1001713113300012090Attine Ant Fungus GardensVDRETARRNMTAGLVAGGFAATVFGLCFIVALLYIAHG*
Ga0137365_1042587223300012201Vadose Zone SoilVDRESARANMTAGLLAGGVAAAIFALCFVAAMLYIAS*
Ga0150985_10041728233300012212Avena Fatua RhizosphereETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS*
Ga0150985_10366951243300012212Avena Fatua RhizosphereETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0150985_11439688333300012212Avena Fatua RhizosphereSDLETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0150985_11601905723300012212Avena Fatua RhizosphereVDRESARKNMTAGLLAAGFATGIFALTFVAALFYIAQG*
Ga0150985_12097604813300012212Avena Fatua RhizosphereISMDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG*
Ga0137371_1001227173300012356Vadose Zone SoilVDRETARLNMSAGLLAGGFAAAIFALCFVAAMLYIAS*
Ga0150984_10412173513300012469Avena Fatua RhizosphereETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0150984_10555946133300012469Avena Fatua RhizosphereMDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG*
Ga0150984_11598261913300012469Avena Fatua RhizosphereETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0157309_1030573323300012895SoilVDRETARKNMSAGLLAGGLAAAVFALCFIAAFLYIAQ*
Ga0157292_100000061153300012900SoilMDRETARKNMGAGLVAGGLAAAVFALCFVAALLYIAQ*
Ga0157292_1006857623300012900SoilVDRETAKRNLTAGLIAGGFATAIFALSFVAALLYIAS*
Ga0157283_1000082523300012907SoilMDRETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0157286_1031013423300012908SoilMDRETARRNMPAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0157290_1000066133300012909SoilMDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0157298_100000041273300012913SoilVDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS*
Ga0157297_1024196823300012914SoilVDRERARSNIAAGLLAGGIAAGVFALAFVVAVLYIAS*
Ga0157302_1022574713300012915SoilVDRESARRNIATGLIAGGIAAAVFALSFVAAVLYIAS*
Ga0137413_1025928823300012924Vadose Zone SoilVDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ*
Ga0137413_1180403913300012924Vadose Zone SoilTDRNPAVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH*
Ga0137404_1086309633300012929Vadose Zone SoilVDRETARANMSAGLLAGGIAAAVFALCFVAAMLYIAS*
Ga0162650_10000030023300012939SoilMDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA*
Ga0164242_1036229323300012942CompostVDRETARRNMTAGLIAGGFSALVFALCFIVALLYIAHG*
Ga0164242_1061238613300012942CompostVDRETARRNMTAGMIAGGFAAVVFALCFIVALLYIAHG*
Ga0164241_10001524213300012943SoilMPLIEIPVVDRETARKNMGAGLVAGAFAAVIFALCFVAAFLYIAQ*
Ga0164241_1001701653300012943SoilMDRETARKNMSSGLVAGGIAASVFALCFIAAFLYIAQ*
Ga0164241_1003664533300012943SoilVDRETAKASMSAGLVAGGIATAIFALCFVAAMLYIAS*
Ga0137410_1125127423300012944Vadose Zone SoilMDRETARKNMSSGLVVGGFAAAIFALSFVVAILYIAQ*
Ga0126375_1204733413300012948Tropical Forest SoilMDRERAGRNISAGLVAAGFAAALFALCFVAAFLYIAQ*
Ga0164300_1034172923300012951SoilVDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0164298_1016328323300012955SoilMDRETARRQLGAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0164298_1072340423300012955SoilVDRETARRNMGAGLVAGGLAAAVFALAFVAALLYIAQ*
Ga0164298_1142005623300012955SoilMDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0164298_1163858613300012955SoilVDRERARSNIATGLLAGAIAAGVFALTFVVAVLYIAS*
Ga0164303_1109633823300012957SoilVDRETAKRNMAAGLWAGGIAAAVFALCFVVAFIYIAS*
Ga0164299_1002267153300012958SoilMDRENARRQMKAGLVAGGIAAGIFALSFFAAFLYLAGS*
Ga0164299_1070612423300012958SoilVDRETAKRRISAGFVAGAFAASVFALSFVVAVLYIAQ*
Ga0164299_1123735413300012958SoilRENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0164308_1060545513300012985SoilMDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0164308_1166047223300012985SoilVDRERARSNISTGLLAGSIAAGVFALTFVVAVLYIAS*
Ga0164304_1109935513300012986SoilVDRETARNNMAAGLVAAGFATAIFALAFVVALFYIAQ*
Ga0164307_1003464723300012987SoilMDRESSRAGLKAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0164307_1060799913300012987SoilRSSGRNPPVDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0164307_1096841233300012987SoilVDRETARKNMAAGLVAGGFAAAIFALAFVAAFLYIAQ*
Ga0164305_1122108013300012989SoilVDRESARRNISTGLLAGGFAAAVFALAFVAAVLYIAS
Ga0157370_1012600523300013104Corn RhizosphereVDRETSRRDIAAGLVAGGIAAAIFALCFVAATLYIAS*
Ga0157378_1001617823300013297Miscanthus RhizosphereMDRETARLQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0157378_1014933843300013297Miscanthus RhizosphereMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0157378_1104637923300013297Miscanthus RhizosphereMDRESARANMSAGLVAGGIATAVFALCFVAAMLYIAS*
Ga0163162_1121768723300013306Switchgrass RhizosphereMDRQTARKNMSSGLIAGGFAAAIFALCFVAAFLYIAQ*
Ga0157375_10009414113300013308Miscanthus RhizosphereMDRETARKNMGAGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0157375_1251461633300013308Miscanthus RhizosphereVDRETSRASIAAGLTAGGIVAAIFALCFVAAVLYIAS*
Ga0157375_1295441513300013308Miscanthus RhizosphereMDRENARANMSAGLVAGGIAAGIFALCFVVAMLYIAS*
Ga0120158_1031075023300013772PermafrostVDRETARRNMSAALVAGGFAAAIFALSFVVALLYIAQ*
Ga0075312_112844613300014254Natural And Restored WetlandsVDRESARKNMSAGLVAGGLAAAVFALCFVVALLYVAQ*
Ga0075312_113464323300014254Natural And Restored WetlandsVDRESARRNISTGLLAGGIAASIFALAFVAALLYIAS*
Ga0075320_103497113300014255Natural And Restored WetlandsVDRETTRANVGAGLSAAGIAVAIFALCFVVAMLYIAS*
Ga0075311_102359823300014259Natural And Restored WetlandsVDRETARANIGAGLVAGGIAAAVFALCFVAATLYIAS*
Ga0075324_10000031843300014263Natural And Restored WetlandsMDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ*
Ga0075313_120730423300014267Natural And Restored WetlandsVDRETARRNMAAGLLAGGIAASVFALCFIAAVLYIAS*
Ga0075325_1000062113300014270Natural And Restored WetlandsVDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS*
Ga0075325_101510833300014270Natural And Restored WetlandsVDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS*
Ga0075325_110479623300014270Natural And Restored WetlandsMDRETSRKDIAAGLIAGGLAAAVFALCFIAATLYIAS*
Ga0075326_125937123300014271Natural And Restored WetlandsVDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS*
Ga0075303_100301923300014299Natural And Restored WetlandsVDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS*
Ga0075321_106917733300014300Natural And Restored WetlandsDRNPPVDRETSRRDMTAGLLAGGIAAAIFALCFVAATLYIAS*
Ga0075323_112103823300014301Natural And Restored WetlandsVDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS*
Ga0075322_100034433300014311Natural And Restored WetlandsVDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS*
Ga0075316_102106513300014314Natural And Restored WetlandsVDRETARANISAGLVAGGIAAAIFALCFVAAMLYIAS*
Ga0163163_1027838743300014325Switchgrass RhizosphereVDRESARASISAGLVAGGVAAAVFALSFVAAVLYIAS*
Ga0163163_1028904623300014325Switchgrass RhizosphereVDRETAKRNLTAGLLAGGIATAVFALSFVAALFYIAS*
Ga0163163_1159363123300014325Switchgrass RhizosphereVDRETARRDLAAGLLAGGIAAGVFTLCFVVAVLYIAS*
Ga0157380_10001343123300014326Switchgrass RhizosphereVDRETARSSISAGLLAGGIAAAVFALSFLAAVLYIAS*
Ga0182000_1000840023300014487SoilVDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS*
Ga0182019_1010393843300014498FenVDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ*
Ga0157377_1020655223300014745Miscanthus RhizosphereVDRETARKNMSSGLVAGGFAAAVFALCFVVAFLYIAQ*
Ga0157379_1008852753300014968Switchgrass RhizosphereVDRETAKGNMVAGLVAGGIAAAVFALCFVAAMLYIAS*
Ga0157379_1071210013300014968Switchgrass RhizospherePDRNPTVDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0157376_1007812533300014969Miscanthus RhizosphereMDRETARRNMRAGLVAGGVAAGIFALSFVAAFLYIAQ*
Ga0167633_11451533300015069Glacier Forefield SoilVDRETARKNMTAGLVAGGFAAGVFALCFIAAFLYIAQS*
Ga0167632_102186123300015085Glacier Forefield SoilVDRETSRRDIAAGLMAGGIAAAIFALCFVAAALYIAQ*
Ga0167643_103112113300015089Glacier Forefield SoilVDRETARRNMTAGLVAGGFAAMVFALCFIVALLSIAH*
Ga0167634_100361023300015090Glacier Forefield SoilMDRETSRRNMAAGLVAGGIAAAIFALCFVAATLYIAS*
Ga0173480_1093111723300015200SoilVDRETARRRIGAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0137412_1096270113300015242Vadose Zone SoilVDREVARKNMSAGLLAGGFAVAIFALSFVAAFLYIAQ*
Ga0137412_1103883113300015242Vadose Zone SoilVDRESARKNMTAGLLAAGFATGIFALTFVAALLYIAQG*
Ga0132258_1106115753300015371Arabidopsis RhizosphereVDRETARKNMSAGLVAGGFAAAIFALCFVAAFLYVAQ*
Ga0163161_1000844623300017792Switchgrass RhizosphereMDRETARKNMGSGLMVGGFAAAIFALCFVAAFLYIAQ
Ga0187825_1012535923300017930Freshwater SedimentMDRQTARANMTAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0190266_1007455623300017965SoilVDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG
Ga0184611_121781823300018067Groundwater SedimentMDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0184618_1015921523300018071Groundwater SedimentVDRDTARRNIGAALLAGAIAASVFALSFVVAVLYIAS
Ga0190265_10000063203300018422SoilMDRETARRNMTSALVAGGIAAAIFALCFVAATLYIAS
Ga0190265_1005481343300018422SoilVDRETSRKDIGAGLLAGAIAAGVFALSFLAAMLYIAS
Ga0190265_1008710333300018422SoilVDRETARRNLTSALVLGGVAATIFALCFVAATLYIAS
Ga0190265_1014845043300018422SoilMDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ
Ga0190272_1001107843300018429SoilVDRESAKQNMSAGLLAGGIAASVFALCFVAAMLYIAS
Ga0190272_1014773143300018429SoilVDRETAKANMSAGLLAGGIAATVFALCFVAAMLYIAS
Ga0190272_1025247323300018429SoilMDRETARKNMAGGLVAAGFATAVFALCFVAAFLYVAQ
Ga0190272_1038709423300018429SoilMDRETARKNMSTGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0066655_1016396713300018431Grasslands SoilMDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190275_10000304143300018432SoilMDRENARRQISAGLITGGIAAGVFALCFVTAFVYIAG
Ga0190275_10003499133300018432SoilVDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ
Ga0190275_1130024223300018432SoilVDRETARRNLSSGLLYGGIAAAIFALCFLASILYIA
Ga0190275_1175887123300018432SoilVDRDTARRNLSAGLLYGGIAAAIFGLCFIASILYIA
Ga0190275_1200953323300018432SoilVDRETARKNMSAGLVAGGFAAAVFALCFVAAFLYIAQ
Ga0190269_10001067113300018465SoilMDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190268_1022573733300018466SoilVDRETARRNLTAGLLYGGIAAAVFALCFIASILYIA
Ga0190270_1002623633300018469SoilVDRETARRNMTAGLLYGGIAAAVFALCFIASILYIA
Ga0190270_1007191913300018469SoilMDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0190270_1056040533300018469SoilVDRELAKRNMSAGLLAGAIAAALFALAFLAAVLYIAS
Ga0190270_1093805513300018469SoilVDRETARKNMSSGLFAGAFVAAVFALSFVAAFLYIAQ
Ga0190270_1203388623300018469SoilVDRETARRNISAGLLAGGIAATIFALSFVAAVLYIAS
Ga0190274_10000037313300018476SoilVDRETSRKNIGAGLLAAGLAAGVFALCFVAALLYIAQ
Ga0190274_10000647233300018476SoilVDRETARANIGAGLVAGGIAAAIFALCFVAAMLYIAS
Ga0190274_1006520423300018476SoilVDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYVAQ
Ga0190274_1027952713300018476SoilPCLPDRNPPVDRETAKRDMGAGLLAGGIAAGVFALCFVAAMLYIAS
Ga0190271_100000131073300018481SoilVDRELAKRNLSSGLLAAAIAAALFALAFLAAVLYIAS
Ga0190271_10000157373300018481SoilVDRETARKNMAAGLVAAGFATAIFALAFVVALFYIAQ
Ga0190271_1002365793300018481SoilMDRENARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0190271_1003732653300018481SoilMDRESARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0190271_1091230523300018481SoilMDRENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAGS
Ga0190273_10000018793300018920SoilMDRETARRNMRAGLVAGGIAAGVFALAFVAAFLYIAQ
Ga0190273_1021201333300018920SoilMDRETARRQMRAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0190273_1049707433300018920SoilMDRETARRNMKAGLLAGGIAAGVFALSFVAAFLYIAQ
Ga0190273_1138543523300018920SoilMDRESSRRNLSAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190264_1025099623300019377SoilVDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0190264_1061491023300019377SoilVDRESARKNMSAGLVAGGFAAAIFALAFVAAFLYIAQG
Ga0193701_110040323300019875SoilMDRETARRQMKAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0193707_108816413300019881SoilVDREAARKNMSAGLVAAGLAAAVFALCFIAAFLYIAQ
Ga0193741_101648733300019884SoilVDRETSKANISAGLMAGGIAAAVFALCFVAAMLYIAS
Ga0193743_100189093300019889SoilVDRETARKNMGAGLVAGGLAAAVFALCFVVAFLYIAQ
Ga0193697_106948623300020005SoilMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0193738_103447743300020020SoilMDRETARKNMGAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0193726_104760043300020021SoilVDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ
Ga0193726_105047713300020021SoilPCLPDRNPPVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS
Ga0193733_110236033300020022SoilVDRETARKNMAGGLAAGGFAAAIFALSFVVALLYIAQ
Ga0193753_1007617743300020034SoilVDRETARKNMSAGLLVGSFAAAIFALSFIVAFLYIA
Ga0193753_1011618343300020034SoilVDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAH
Ga0193745_102478633300020059SoilMDRETSRRDMAAGLVAGGIAAAIFALCFVAATLYIAS
Ga0197907_1087087533300020069Corn, Switchgrass And Miscanthus RhizosphereDRNQGVDRETARRNMTAGLVAGGFAAAIFALCFIVALLWIAH
Ga0206356_1066662753300020070Corn, Switchgrass And Miscanthus RhizosphereMDRETARRNLSAGLLAGGIATAVFALCFVAGFLYIAQ
Ga0206351_1040839113300020077Corn, Switchgrass And Miscanthus RhizosphereRETARRSMTAGLVAGGFAAMVFAACFIVALLYIAH
Ga0196965_116621423300020154SoilVDRETARKNMSAGLVAGAFAASVFSLAFVAALLYIAQ
Ga0196958_10002198103300020181SoilMDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0196958_1014359833300020181SoilMDRETARRSMSAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0196958_1021224623300020181SoilMDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ
Ga0154015_154096923300020610Corn, Switchgrass And Miscanthus RhizosphereMDRQSARNSMRAGLIAGGIAAGIFALSFVAAFLYIAS
Ga0179596_1063828913300021086Vadose Zone SoilVDRETARRNMTAGLVAGGFAALVFALCFIVALLYIAH
Ga0193706_100709353300021339SoilVDRETVRKNIGAGLFAGALAAAVFALCFVAAFLYVA
Ga0193706_101239023300021339SoilVDRETARKNMSGALVVGGLAAAVFALCFVAAFLYIAQ
Ga0193706_105302243300021339SoilMDRETSRKNMTGGLVAAGFATAIFALSFVAAFLYIAQG
Ga0193699_1011950423300021363SoilMDRETARRQMKAGLVAGGIAAGVFALSFVAAFLYIAA
Ga0210393_1029570033300021401SoilMDRETARKNMIGGLMAGGFAAAIFALAFVVAFLYIAQ
Ga0210397_1008556623300021403SoilVDRETARRNMTAGLVAGGFAATVFALCFIVALLYVAH
Ga0193736_105798723300021412SoilVDRETARKNMGAGLFAGAFVAAIFALCFIVAFLYIAQ
Ga0182009_1064176123300021445SoilVDRETARRNLTAGLVAGGIAAAVFALSFVAAVLYIAS
Ga0210409_1001005333300021559SoilVDRETARRKMSAGLVAGGLAAAVFALSFLVALLYIAQ
Ga0126371_1093622423300021560Tropical Forest SoilMDRESARNSMRAGLIAGGIAAGIFALSFVAAFLYLAS
Ga0222622_1004902253300022756Groundwater SedimentVDRETARRNMIGGLVAGGFAAAIFALSFVVALLYIAQ
Ga0222622_1060376913300022756Groundwater SedimentGRNPPVDRESARRNMGAGLVAGGIAAGIFALSFLVAVLYIAS
Ga0247792_101115833300022880SoilMDRETARRNMRAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0247795_1000128133300022899SoilMDRETARRNLSAGLVTGGIAAGVFALCFVAAFLYIAQ
Ga0247768_1000016263300022910Plant LitterMDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0247743_100204443300023067SoilMDREQARASVSAGLVAGLVAAAVFALCFVAAMLYIAS
Ga0247754_100075233300023102SoilVDRETAKRNISGGLLAGGIAAGVFALCFVVAMLYIAS
Ga0247780_1001443103300023265Plant LitterMDRETARRNISSGLFAGALAASVFALCFVAALLYIAQ
Ga0247789_101055133300023266SoilMDRETARRSLRAGLVAGGIAAGVFALAFVTAFLYIAQ
Ga0247789_105655523300023266SoilMDRETARRSMSAGLVAGGIAVGVFALCFVTAFVYIAQ
Ga0247765_100532523300023268Plant LitterMDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0247776_10000281113300023275Plant LitterMDRETARRQMGAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0247794_1006355023300024055SoilMDRETARTNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0179591_118088333300024347Vadose Zone SoilVDRETARKNMSAGLLAGGLAAAVFALAFVAALLYIAQ
Ga0196960_1000057943300024426SoilMDRETARKNMSAGLTAGGIAAGVFALCFVTAFIYIAG
Ga0196960_1006378533300024426SoilMDRESARKNISAGLVAGGIAVGIFALAFVTAFIYIAQ
Ga0196962_10000259153300024430SoilVDRETARKNMGAGLLAGGIAAAVFALSFVAALLYIA
Ga0209916_100095113300024996Wastewater BioreactorVDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG
Ga0207656_1001741243300025321Corn RhizosphereMDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG
Ga0208356_1000005773300025504Arctic Peat SoilMDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ
Ga0207423_100983713300025535Natural And Restored WetlandsSRTRAVDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS
Ga0210132_100013923300025538Natural And Restored WetlandsVDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS
Ga0210142_100658533300025552Natural And Restored WetlandsMDRETARRNISSGLLTGGIAAAVFALCFVAAMLYVAS
Ga0210110_100265043300025565Natural And Restored WetlandsVDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS
Ga0210110_101085553300025565Natural And Restored WetlandsPGLIEIRLVDRETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS
Ga0210095_101712043300025568Natural And Restored WetlandsVDRETSKREMAAGLQAGAFAAAVFALCFVAAMFYIAS
Ga0207874_106080113300025571Ionic Liquid And High Solid EnrichedVDRETARKNMATGLAAGGFAAAIFALTFVAAILYIA
Ga0210085_1000593193300025583Natural And Restored WetlandsMDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS
Ga0210096_119820023300025593Natural And Restored WetlandsVDRETSRRDISAGLMAGGIAATIFALCFVAATLYIAS
Ga0210086_101318223300025615Natural And Restored WetlandsMDRETARRNVVAGLLTGGIAAAIFALCFVAAMLYIAS
Ga0210086_110104533300025615Natural And Restored WetlandsMDRETARRNMSSGLLTGGIAAAVFALCFVAAMLYVAT
Ga0208219_100313873300025625Arctic Peat SoilMDRETARRNMTTGLMTGGFAAAIFALSFVVAFLYIAQ
Ga0208589_110083423300025634Arctic Peat SoilVDRETARKNMTAGLVAGGLAATVFALCFIVALLYIAH
Ga0210100_100023073300025780Natural And Restored WetlandsMDRESARAKMSAGLVAGGIAAGIFALCFVVAMLYIAS
Ga0210100_100025193300025780Natural And Restored WetlandsMDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ
Ga0210063_1000059123300025798Natural And Restored WetlandsVDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA
Ga0210122_100905753300025799Natural And Restored WetlandsVDRESSRQDIRAGLVAGGFAAAVFGLCFVAAMLYIAS
Ga0210101_1000196113300025814Natural And Restored WetlandsVDRETSRRDIGAGLTAGAFAAAVFALCFVAAMLYIAS
Ga0210101_1000339133300025814Natural And Restored WetlandsMDRETAKRDLTAGLVVGGIAAGVFALCFVTAMLYIAS
Ga0210101_110476423300025814Natural And Restored WetlandsVDRELAKRNMSGGLIVGGLAAAVFALSFVAAMLYIAS
Ga0210144_1000148273300025817Natural And Restored WetlandsMDRETARRELTAGLVTGGIAAGVFALCFVAAMLYIAS
Ga0210144_1000280283300025817Natural And Restored WetlandsVDRETARRDLTAGLVAGGIAAGVFALCFVTAMLYIAS
Ga0210144_112947933300025817Natural And Restored WetlandsVDRETAKRNVSAGLLAGGIAASIFALTFVAAMLYIAS
Ga0210123_104981323300025823Natural And Restored WetlandsVDRESAQGNIGAGLLAGGIAVGVFALAFVVAVLYIAS
Ga0210123_112242623300025823Natural And Restored WetlandsVDRETSRRDISAGLMAGGIAAAIFALCFVAATLYIAS
Ga0209176_1001678023300025854Arctic Peat SoilVDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS
Ga0209584_1027722823300025878Arctic Peat SoilVDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ
Ga0207692_1012678723300025898Corn, Switchgrass And Miscanthus RhizosphereMDRETARRNIGSGLMLGGFAAAIFALSFVAALLNIAQ
Ga0207642_100000051983300025899Miscanthus RhizosphereVDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS
Ga0207642_10000737113300025899Miscanthus RhizosphereMDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS
Ga0207642_1001934843300025899Miscanthus RhizosphereMDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0207685_10000012393300025905Corn, Switchgrass And Miscanthus RhizosphereVDRETARAKMSAGLLAGGIAAAIFALCFVAATLYVAS
Ga0207699_1113322023300025906Corn, Switchgrass And Miscanthus RhizosphereVDRETAKRNMAAGLLAAGIAAVVFALCFVAAFMYIAS
Ga0207643_1066373413300025908Miscanthus RhizosphereTGLSSRNPAMDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ
Ga0207654_1065042913300025911Corn RhizosphereVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG
Ga0207707_1005981753300025912Corn RhizosphereVDRETARANIGAGLVAGGITAAIFALCFVAAMLYIAS
Ga0207707_1109544823300025912Corn RhizosphereVDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS
Ga0207693_10010825113300025915Corn, Switchgrass And Miscanthus RhizosphereMDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ
Ga0207693_1121299423300025915Corn, Switchgrass And Miscanthus RhizosphereVDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS
Ga0207657_1016665323300025919Corn RhizosphereMDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS
Ga0207694_100000121273300025924Corn RhizosphereMDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS
Ga0207694_1049654123300025924Corn RhizosphereVDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0207659_10000055353300025926Miscanthus RhizosphereMDRETARRQMRAGLIAGGVAAGIFALSFVAAFLYIAQ
Ga0207687_1002095523300025927Miscanthus RhizosphereMDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ
Ga0207700_100000031793300025928Corn, Switchgrass And Miscanthus RhizosphereMDRESARQSMRAGLVAGGIAAAIFALSFVAAFLYIAS
Ga0207664_10015535103300025929Agricultural SoilMDRESARRNLRAGLLAGGIAAGIFALSFVAAFLYLAQ
Ga0207686_1033943023300025934Miscanthus RhizosphereVDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH
Ga0207669_1010729343300025937Miscanthus RhizosphereVDRERSRSNIATGLLAGGIAAGVFALAFVVAVLYIAS
Ga0207704_1024534723300025938Miscanthus RhizosphereVDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ
Ga0207704_1125364733300025938Miscanthus RhizosphereMDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0207665_1143742423300025939Corn, Switchgrass And Miscanthus RhizosphereVDRETARRNMIGGLVAGGFAAAIFALSFVVALLYVAQ
Ga0210126_10046423300025946Natural And Restored WetlandsVDRETARAGISAGLLAGGIAAAVFALSFVAAVLYIAS
Ga0207667_1061709323300025949Corn RhizosphereVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH
Ga0207667_1070031623300025949Corn RhizosphereVDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS
Ga0207712_100000272303300025961Switchgrass RhizosphereVDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS
Ga0207712_1104529023300025961Switchgrass RhizosphereVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH
Ga0207712_1121398423300025961Switchgrass RhizosphereVDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0207658_1010394733300025986Switchgrass RhizosphereMDRQTARKNMSSGLVAGGFAAAIFALCFVAAFLYIAQ
Ga0207658_1048628413300025986Switchgrass RhizosphereARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG
Ga0207658_1053270913300025986Switchgrass RhizosphereMDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAG
Ga0208777_101076123300025996Rice Paddy SoilVDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS
Ga0208777_101326633300025996Rice Paddy SoilVDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS
Ga0207677_10003648103300026023Miscanthus RhizosphereVDRESARASISASLVAGGIAAAVFALSFVAAVLYIAS
Ga0207677_1000900143300026023Miscanthus RhizosphereMDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0208911_100026133300026051Natural And Restored WetlandsVDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS
Ga0208911_100491623300026051Natural And Restored WetlandsVDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS
Ga0208421_101867623300026058Natural And Restored WetlandsVDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS
Ga0208290_100003963300026066Natural And Restored WetlandsVDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS
Ga0207678_1011878523300026067Corn RhizosphereMDRETSRRDMAAGLMAGGIAAAIFALCFVAATLYIAS
Ga0207678_1034711233300026067Corn RhizosphereVDRERARRSIGAGLLAGGIAAGVFALAFVVAVLYIAS
Ga0207708_1052494733300026075Corn, Switchgrass And Miscanthus RhizosphereMDRESARKNMSSGLVAGALAASVFALCFVAAFLYIAQ
Ga0207641_1007602753300026088Switchgrass RhizosphereVDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS
Ga0207676_100000162893300026095Switchgrass RhizosphereVDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS
Ga0209950_100505833300026107SoilVDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS
Ga0207683_1019674213300026121Miscanthus RhizosphereVDRETARAKMSAGLLAGGIAAAIFALCFVATMLYVAS
Ga0207698_1159335023300026142Corn RhizosphereMDRETARANIGAGLVAGGIVAAVFALCFVAAMLYIAS
Ga0207698_1172107713300026142Corn RhizosphereLVDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0207698_1226568213300026142Corn RhizosphereVDRESARASISAGLVAGGVAAAVFALSFVAAVLYVAS
Ga0208998_1000008313300027524Forest SoilVDRETARKSISSGLVAGGFAAAVFALCFVVALLYIAQ
Ga0214469_100289733300027636SoilVDRETAKSSISTGMVTGGIAAAIYALCFVAAIFYIAS
Ga0214469_114576623300027636SoilVDRETARRNISGGLLAGAIAAAVFALCFVAAMLYIAS
Ga0209178_135822623300027725Agricultural SoilMDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0209074_1044744423300027787Agricultural SoilMDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ
Ga0209382_1002353473300027909Populus RhizosphereVDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ
Ga0247662_106497923300028293SoilMDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ
Ga0268266_1001558833300028379Switchgrass RhizosphereMDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA
Ga0268266_1119904233300028379Switchgrass RhizosphereAVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH
Ga0268265_1243078113300028380Switchgrass RhizosphereDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0268264_10001191113300028381Switchgrass RhizosphereVDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS
Ga0268264_1213791723300028381Switchgrass RhizosphereVDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS
Ga0265337_100125663300028556RhizosphereVDRETARRNMTAGLVAGGFAAGMFALSFIVALLYIAQ
Ga0265337_119959323300028556RhizosphereVDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ
Ga0265326_1015648323300028558RhizosphereVDRETARKNMVGGLVAAGFAAAIFALAFVAAFLYIAQ
Ga0307285_10000004273300028712SoilMDRENARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307309_1005619623300028714SoilMDRESARANMSAGLVAGGLATAVFALCFVAAMLYIAS
Ga0307315_1005766023300028721SoilMDRETARRNMRAGLVAAGFAAGIFALSFVAAFLYIAQ
Ga0307280_10000024503300028768SoilMDRESARRQMRAGLVAGGIAAGVFALSFVAAFLYIAQ
Ga0307280_1025223813300028768SoilDRESARRNIATGLLAGGIAAGIFALAFVAAVLYIAS
Ga0307280_1026010323300028768SoilVDRERARSNIATGLLAGGIAAAVFALAFVAAVLYIAS
Ga0307306_1000004453300028782SoilMDRETARRNMSAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307503_10000132273300028802SoilVDRETARANMAAGLTAGGIAAAVFALCFVAAMLYIAS
Ga0307503_1062973423300028802SoilMDREHAKRSMSAGLLAGAFAAAIFALAFLAAVLYVAS
Ga0307289_1003562623300028875SoilVDRETARRNMIGGLVAGGFATAIFALSFVVALLYIAQ
Ga0311334_1182094613300029987FenMDRESARRNLGSGLVIGAIAAGIFALSFIVATLYIASA
Ga0299907_1020308733300030006SoilMDRETARRNLGSGLLIGSFAAFVFALSFLTAMLYIAQ
Ga0268259_1009239523300030499AgaveMDRENARRNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0268243_100686523300030510SoilVDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS
Ga0307499_1000523653300031184SoilVDRETARRDIGAGLLAGGIAAGVFALCFVAAMLYIAS
Ga0307497_1048917313300031226SoilVDRETARAKMSAGLLAGGIAAAIFALCFVAATLYIAS
Ga0299914_1000019183300031228SoilVDRESARSSVAAGLLAGGVAAGVFALCFVAAMLYIAS
Ga0299914_1001064353300031228SoilVDRESTKQNISAGLLAGAFAAAIFALSFIAAMLYIAS
Ga0299913_1009329423300031229SoilVDRETSKRSMTTGLLAGGVAAAVFALTFLAATLYIAT
Ga0307442_113213223300031274Salt MarshMDRETARRELTAGLVAGGIAAAVFALCFVTAVLYIA
Ga0307440_100772223300031367Salt MarshVDRETSRRDITAGLLAGGIAAAIFALCFVAATLYIAS
Ga0307440_114347413300031367Salt MarshMDRETARKNMVGGLVAGGFATAIFALAFVAAFLYVAQ
Ga0102761_1217361213300031411SoilVDRETARRNMFAGMAAAGFAAVVFALCFIVALLYIAH
Ga0307468_10102894713300031740Hardwood Forest SoilMDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0315297_1035409723300031873SedimentVDRESAKRNIGGGLAFGAFAAGMFALAFVAAMLYIAP
Ga0308175_100000371353300031938SoilMDRELARKNMRAGLVAGGLATAVFALAFVAAVLYIAQ
Ga0308176_1048799123300031996SoilVDRETARRDLTAGLVAGGIAAAIFALCFVAATLYIAS
Ga0307416_10306402933300032002RhizosphereELRTMDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0308173_1185242123300032074SoilMDRETARRQMRAGLVVGGIAAGIFALSFVAAFLYIAQ
Ga0326721_10000051253300032080SoilMDRETARRSIGAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0307415_10064946023300032126RhizosphereMDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0315912_1120165923300032157SoilMDRESARRQLSAGLVAGGIAAGVFALSFVAAFLYIAA
Ga0307470_1000878133300032174Hardwood Forest SoilVDRETSRRDIGAGLLAAGIAAGIFAICFVVATLYIAS
Ga0307470_1108019523300032174Hardwood Forest SoilMDRESARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307471_10017877653300032180Hardwood Forest SoilDRNLAVDRETARRKVSAGLVAGGFAAAVFALSFVVALLYIAQ
Ga0307472_10118998723300032205Hardwood Forest SoilMDRESSRAGIKAGLVAGGIAAGIFALSFVAAFLYIAS
Ga0307472_10142836523300032205Hardwood Forest SoilVDRETAKSNMTAGLLAGGVAAAIFALSFVVAVLYIAS
Ga0335070_10000099803300032829SoilVDRETARKNMVGGLVAGGFAAAIFALTFVAAFLYIAAS
Ga0335070_1010914753300032829SoilVDRDLARKNMVGALVAGGFAAAIFALCFVAALLYIAQ
Ga0335070_1019073943300032829SoilMDRETARRNMAGGLVAAGFATAIFALSFVAAFLYIAQG
Ga0335070_1023849723300032829SoilMDRETARANMSAGLLAGGIAAAIFALCFVAAMLYIAS
Ga0335075_1046671833300032896SoilVDRETARKNMSAGLVAGGIAAAVFALAFVAAFLYVGAA
Ga0335075_1129361823300032896SoilVDRETARRNMTAGLVAGGFAAAVFALSFIVALLYIAH
Ga0335083_100000841003300032954SoilVDRETAHKGMTAGLIAGGFSALVFALCFIVALLYIAH
Ga0335083_1133663223300032954SoilMDRELARKNIRAGLIAGGVAAAVFALCFAVAFLYIAS
Ga0326726_1002803463300033433Peat SoilMDRETARQRLSAGLLAGGIAAGVFALCFIVATLYIAS
Ga0370484_0042838_906_10193300034125Untreated Peat SoilVDRETARRNMTAGLVAGGLAAAVFALSFIVALLYIAQ
Ga0370490_0174418_49_1623300034128Untreated Peat SoilVDRETSRANISAGLLAGGIGAAVFALCFVAAVLYIAS
Ga0364925_0018486_2087_21943300034147SedimentRETARRDIAAGLVAGGIAAGVFALCFVAAVLYIAS
Ga0334960_000648_11082_111953300034402Sub-Biocrust SoilVDRETSKRQISAGLVAGGFAAAVFALCFVAATLYIAS
Ga0334905_000287_4010_41233300034687SoilVDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS
Ga0364923_0014158_404_5173300034690SedimentVDRETARRDMAAGLVAGGIAAGVFALCFVAAVLYIAS
Ga0334935_102643_647_7573300034781BiocrustVDRDTARRNIGSGLLYGGIAAAIFALCFIASILYIA
Ga0370497_0055924_631_7443300034965Untreated Peat SoilVDRETARTNMGAGLLAGGIAAAVFALCFVAAMLYIAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.