NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F001488

Metagenome / Metatranscriptome Family F001488

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F001488
Family Type Metagenome / Metatranscriptome
Number of Sequences 686
Average Sequence Length 133 residues
Representative Sequence MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Number of Associated Samples 469
Number of Associated Scaffolds 686

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.37 %
% of genes near scaffold ends (potentially truncated) 34.40 %
% of genes from short scaffolds (< 2000 bps) 59.33 %
Associated GOLD sequencing projects 418
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.055 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(22.303 % of family members)
Environment Ontology (ENVO) Unclassified
(30.758 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(64.723 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.70%    β-sheet: 21.38%    Coil/Unstructured: 45.91%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.55.1.1: Ribosomal protein L22d1vq8r11vq80.74829
d.55.1.1: Ribosomal protein L22d1i4ja_1i4j0.7321
b.82.2.0: automated matchesd6kwaa_6kwa0.55606
a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI)d3fr7a23fr70.55418
b.82.2.0: automated matchesd6lsva_6lsv0.54885


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 686 Family Scaffolds
PF00203Ribosomal_S19 28.57
PF00237Ribosomal_L22 25.66
PF03947Ribosomal_L2_C 8.89
PF07650KH_2 4.96
PF00252Ribosomal_L16 4.81
PF00276Ribosomal_L23 3.50
PF00573Ribosomal_L4 2.04
PF00831Ribosomal_L29 1.90
PF00366Ribosomal_S17 1.46
PF00297Ribosomal_L3 1.17
PF00238Ribosomal_L14 1.17
PF00012HSP70 1.02
PF17136ribosomal_L24 0.73
PF00338Ribosomal_S10 0.58
PF02597ThiS 0.58
PF03144GTP_EFTU_D2 0.58
PF00177Ribosomal_S7 0.44
PF05690ThiG 0.44
PF00347Ribosomal_L6 0.44
PF00380Ribosomal_S9 0.44
PF00344SecY 0.44
PF03912Psb28 0.44
PF00411Ribosomal_S11 0.44
PF10431ClpB_D2-small 0.44
PF07517SecA_DEAD 0.44
PF00673Ribosomal_L5_C 0.29
PF00118Cpn60_TCP1 0.29
PF03719Ribosomal_S5_C 0.29
PF00886Ribosomal_S16 0.29
PF00444Ribosomal_L36 0.29
PF01197Ribosomal_L31 0.29
PF00861Ribosomal_L18p 0.15
PF00410Ribosomal_S8 0.15
PF00416Ribosomal_S13 0.15
PF03118RNA_pol_A_CTD 0.15
PF01250Ribosomal_S6 0.15
PF00572Ribosomal_L13 0.15
PF03466LysR_substrate 0.15

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 686 Family Scaffolds
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 28.57
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 25.66
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 8.89
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 4.81
COG0089Ribosomal protein L23Translation, ribosomal structure and biogenesis [J] 3.50
COG0088Ribosomal protein L4Translation, ribosomal structure and biogenesis [J] 2.04
COG0255Ribosomal protein L29Translation, ribosomal structure and biogenesis [J] 1.90
COG0186Ribosomal protein S17Translation, ribosomal structure and biogenesis [J] 1.46
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 1.17
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 1.17
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 1.02
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.58
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.58
COG0051Ribosomal protein S10Translation, ribosomal structure and biogenesis [J] 0.58
COG0201Preprotein translocase subunit SecYIntracellular trafficking, secretion, and vesicular transport [U] 0.44
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.44
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 0.44
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 0.44
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.44
COG0049Ribosomal protein S7Translation, ribosomal structure and biogenesis [J] 0.44
COG0097Ribosomal protein L6P/L9ETranslation, ribosomal structure and biogenesis [J] 0.44
COG0100Ribosomal protein S11Translation, ribosomal structure and biogenesis [J] 0.44
COG0103Ribosomal protein S9Translation, ribosomal structure and biogenesis [J] 0.44
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.29
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 0.29
COG0257Ribosomal protein L36Translation, ribosomal structure and biogenesis [J] 0.29
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.29
COG0094Ribosomal protein L5Translation, ribosomal structure and biogenesis [J] 0.29
COG0098Ribosomal protein S5Translation, ribosomal structure and biogenesis [J] 0.29
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.15
COG0256Ribosomal protein L18Translation, ribosomal structure and biogenesis [J] 0.15
COG0360Ribosomal protein S6Translation, ribosomal structure and biogenesis [J] 0.15
COG0096Ribosomal protein S8Translation, ribosomal structure and biogenesis [J] 0.15
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 0.15
COG0102Ribosomal protein L13Translation, ribosomal structure and biogenesis [J] 0.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.71 %
UnclassifiedrootN/A0.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352005|2199916469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27128Open in IMG/M
3300000120|SA_S2_NOR13_50mDRAFT_c1000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria28185Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10000204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria20686Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10001838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae → Gloeothece7699Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10006814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae3868Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10007368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3699Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10035154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1435Open in IMG/M
3300000126|BS_KBB_SWE26_205mDRAFT_c1019380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1116Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10116704All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta591Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10226051All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta515Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10134399All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta617Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1031477All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1161Open in IMG/M
3300000422|BB_Man_A_Liq_inBBDRAFT_1010439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1010Open in IMG/M
3300002153|JGI24540J26637_10017241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2978Open in IMG/M
3300002396|B570J29629_1021827All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Saccharomycetaceae → Naumovozyma → Naumovozyma castellii520Open in IMG/M
3300002404|B570J29591_1000066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15091Open in IMG/M
3300002447|JGI24768J34885_10025568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1966Open in IMG/M
3300002835|B570J40625_100004039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27484Open in IMG/M
3300003247|JGI26116J46587_1022474All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta601Open in IMG/M
3300003265|JGI26118J46590_1020439All Organisms → cellular organisms → Eukaryota → Sar784Open in IMG/M
3300003265|JGI26118J46590_1022089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens752Open in IMG/M
3300003268|JGI26115J46592_1041309All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta535Open in IMG/M
3300003346|JGI26081J50195_1010901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2307Open in IMG/M
3300003428|JGI26111J50215_1026892All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta725Open in IMG/M
3300003549|Ga0008452J51689_111759All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens854Open in IMG/M
3300003554|Ga0008451J51688_105043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria12887Open in IMG/M
3300003566|Ga0008455J51687_1016173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1622Open in IMG/M
3300003617|JGI26082J51739_10026336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2280Open in IMG/M
3300003621|JGI26083J51738_10044157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1131Open in IMG/M
3300003677|Ga0008458J53046_105136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4607Open in IMG/M
3300003682|Ga0008456_1033379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2069Open in IMG/M
3300003691|JT63_1002746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9392Open in IMG/M
3300003712|Ga0008276_105140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria982Open in IMG/M
3300003860|Ga0031658_1000353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales7621Open in IMG/M
3300003860|Ga0031658_1002529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3309Open in IMG/M
3300003910|JGI26437J51864_10000126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22292Open in IMG/M
3300004097|Ga0055584_101717118All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta648Open in IMG/M
3300004097|Ga0055584_102124740All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta573Open in IMG/M
3300005069|Ga0071350_1000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26977Open in IMG/M
3300005417|Ga0068884_1570668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2139Open in IMG/M
3300005420|Ga0068879_1686147All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta818Open in IMG/M
3300005527|Ga0068876_10025889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3676Open in IMG/M
3300005528|Ga0068872_10732283All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300005585|Ga0049084_10000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39358Open in IMG/M
3300005758|Ga0078117_1000266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22367Open in IMG/M
3300005758|Ga0078117_1000303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria23046Open in IMG/M
3300005805|Ga0079957_1030231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3599Open in IMG/M
3300005805|Ga0079957_1091658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1683Open in IMG/M
3300005824|Ga0074474_1386249All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta609Open in IMG/M
3300005831|Ga0074471_10334037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7516Open in IMG/M
3300005833|Ga0074472_10627141All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300005920|Ga0070725_10328342All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta675Open in IMG/M
3300005940|Ga0073913_10000038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria23862Open in IMG/M
3300005941|Ga0070743_10001553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8707Open in IMG/M
3300005942|Ga0070742_10002369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4878Open in IMG/M
3300005942|Ga0070742_10020781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1741Open in IMG/M
3300005943|Ga0073926_10000345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9840Open in IMG/M
3300005961|Ga0075157_10000579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria28040Open in IMG/M
3300005987|Ga0075158_10198632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1153Open in IMG/M
3300005988|Ga0075160_10331799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta829Open in IMG/M
3300005989|Ga0075154_10000961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22016Open in IMG/M
3300005990|Ga0073921_1105224All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta539Open in IMG/M
3300006164|Ga0075441_10000391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22632Open in IMG/M
3300006164|Ga0075441_10003141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7624Open in IMG/M
3300006355|Ga0075501_1083373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3674Open in IMG/M
3300006357|Ga0075502_1001332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1074Open in IMG/M
3300006357|Ga0075502_1011257All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300006357|Ga0075502_1065211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1467Open in IMG/M
3300006373|Ga0075483_1301599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria836Open in IMG/M
3300006374|Ga0075512_1062857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3681Open in IMG/M
3300006375|Ga0075490_1310993All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta573Open in IMG/M
3300006378|Ga0075498_1051386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3682Open in IMG/M
3300006382|Ga0075494_1326224All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta695Open in IMG/M
3300006383|Ga0075504_1049235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1218Open in IMG/M
3300006383|Ga0075504_1057647All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta924Open in IMG/M
3300006384|Ga0075516_1426827All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300006390|Ga0075509_1020812All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta693Open in IMG/M
3300006393|Ga0075517_1535478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria729Open in IMG/M
3300006394|Ga0075492_1053957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3669Open in IMG/M
3300006394|Ga0075492_1543797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2104Open in IMG/M
3300006396|Ga0075493_1058351All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta833Open in IMG/M
3300006397|Ga0075488_1571554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3811Open in IMG/M
3300006397|Ga0075488_1641461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1228Open in IMG/M
3300006399|Ga0075495_1048884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3971Open in IMG/M
3300006402|Ga0075511_1766001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1378Open in IMG/M
3300006484|Ga0070744_10009964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2817Open in IMG/M
3300006571|Ga0075505_1006248All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300006571|Ga0075505_1033619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3428Open in IMG/M
3300006571|Ga0075505_1417254All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta513Open in IMG/M
3300006571|Ga0075505_1489124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1993Open in IMG/M
3300006641|Ga0075471_10011176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5497Open in IMG/M
3300006803|Ga0075467_10071644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2110Open in IMG/M
3300006805|Ga0075464_11016247All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta521Open in IMG/M
3300006869|Ga0075477_10166218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales916Open in IMG/M
3300006869|Ga0075477_10258721All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta699Open in IMG/M
3300006874|Ga0075475_10005008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6775Open in IMG/M
3300006874|Ga0075475_10043058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2145Open in IMG/M
3300006875|Ga0075473_10155498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria919Open in IMG/M
3300006917|Ga0075472_10000164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26896Open in IMG/M
3300006917|Ga0075472_10059917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1814Open in IMG/M
3300006917|Ga0075472_10106535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1366Open in IMG/M
3300007102|Ga0102541_1451770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1041Open in IMG/M
3300007169|Ga0102976_1053757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2722Open in IMG/M
3300007212|Ga0103958_1054298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3806Open in IMG/M
3300007214|Ga0103959_1255685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1924Open in IMG/M
3300007228|Ga0075175_1051922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria12590Open in IMG/M
3300007228|Ga0075175_1397247All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta759Open in IMG/M
3300007230|Ga0075179_1075455All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta520Open in IMG/M
3300007230|Ga0075179_1090794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria952Open in IMG/M
3300007232|Ga0075183_10113027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria843Open in IMG/M
3300007236|Ga0075463_10025833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1924Open in IMG/M
3300007237|Ga0075177_1500949All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta727Open in IMG/M
3300007241|Ga0075170_1567750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3951Open in IMG/M
3300007244|Ga0075167_11003757All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta658Open in IMG/M
3300007253|Ga0075182_10101585All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta675Open in IMG/M
3300007253|Ga0075182_11305095All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta575Open in IMG/M
3300007319|Ga0102691_1481643All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta739Open in IMG/M
3300007543|Ga0102853_1010339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1465Open in IMG/M
3300007545|Ga0102873_1120366All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta793Open in IMG/M
3300007550|Ga0102880_1077007All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta881Open in IMG/M
3300007551|Ga0102881_1019956All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1889Open in IMG/M
3300007551|Ga0102881_1029862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1532Open in IMG/M
3300007551|Ga0102881_1081443All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta900Open in IMG/M
3300007552|Ga0102818_1000704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7743Open in IMG/M
3300007555|Ga0102817_1059066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta837Open in IMG/M
3300007557|Ga0102821_1032551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1381Open in IMG/M
3300007557|Ga0102821_1143918All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta605Open in IMG/M
3300007558|Ga0102822_1142260All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta567Open in IMG/M
3300007559|Ga0102828_1051045All Organisms → cellular organisms → Eukaryota → Sar961Open in IMG/M
3300007559|Ga0102828_1103472All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta694Open in IMG/M
3300007560|Ga0102913_1125957All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta829Open in IMG/M
3300007585|Ga0102916_1002471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3987Open in IMG/M
3300007593|Ga0102918_1001241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya5565Open in IMG/M
3300007621|Ga0102872_1209503All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta511Open in IMG/M
3300007623|Ga0102948_1012654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2925Open in IMG/M
3300007623|Ga0102948_1026262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1936Open in IMG/M
3300007623|Ga0102948_1034523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1654Open in IMG/M
3300007629|Ga0102895_1062620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales955Open in IMG/M
3300007630|Ga0102903_1167331All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta601Open in IMG/M
3300007636|Ga0102856_1008196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1417Open in IMG/M
3300007637|Ga0102906_1103338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales790Open in IMG/M
3300007637|Ga0102906_1106082All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta778Open in IMG/M
3300007644|Ga0102902_1008177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3082Open in IMG/M
3300007653|Ga0102868_1005288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2550Open in IMG/M
3300007661|Ga0102866_1077218All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens820Open in IMG/M
3300007661|Ga0102866_1212028All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300007665|Ga0102908_1005872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2304Open in IMG/M
3300007667|Ga0102910_1020086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1502Open in IMG/M
3300007667|Ga0102910_1074702All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta780Open in IMG/M
3300007681|Ga0102824_1159967All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta593Open in IMG/M
3300007692|Ga0102823_1053160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1084Open in IMG/M
3300007706|Ga0102899_1151099All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta577Open in IMG/M
3300007708|Ga0102859_1026896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1528Open in IMG/M
3300007715|Ga0102827_1000236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16438Open in IMG/M
3300007718|Ga0102852_1000386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales7914Open in IMG/M
3300007725|Ga0102951_1009209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3345Open in IMG/M
3300007784|Ga0102955_1004594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2869Open in IMG/M
3300007955|Ga0105740_1001513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2598Open in IMG/M
3300007981|Ga0102904_1007095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2410Open in IMG/M
3300007981|Ga0102904_1017534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1581Open in IMG/M
3300007981|Ga0102904_1024707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1339Open in IMG/M
3300008021|Ga0102922_1246736All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta560Open in IMG/M
3300008052|Ga0102893_1114192All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta798Open in IMG/M
3300008114|Ga0114347_1122418All Organisms → cellular organisms → Eukaryota → Sar972Open in IMG/M
3300008117|Ga0114351_1077967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1986Open in IMG/M
3300008117|Ga0114351_1099009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1703Open in IMG/M
3300008117|Ga0114351_1299976All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta760Open in IMG/M
3300008119|Ga0114354_1006165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales5666Open in IMG/M
3300008119|Ga0114354_1042624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1969Open in IMG/M
3300008119|Ga0114354_1099726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1153Open in IMG/M
3300008120|Ga0114355_1174471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1315Open in IMG/M
3300008258|Ga0114840_1000323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13202Open in IMG/M
3300008258|Ga0114840_1056007All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300008510|Ga0110928_1008041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1799Open in IMG/M
3300008950|Ga0102891_1085226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales961Open in IMG/M
3300008961|Ga0102887_1164090All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta684Open in IMG/M
3300008995|Ga0102888_1007202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2058Open in IMG/M
3300008995|Ga0102888_1046947All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta831Open in IMG/M
3300008995|Ga0102888_1124755All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta534Open in IMG/M
3300008999|Ga0102816_1160795All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta697Open in IMG/M
3300008999|Ga0102816_1311472All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta502Open in IMG/M
3300009000|Ga0102960_1320251All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta547Open in IMG/M
3300009001|Ga0102963_1322376All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta607Open in IMG/M
3300009001|Ga0102963_1435815All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M
3300009002|Ga0102810_1103807All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta885Open in IMG/M
3300009003|Ga0102813_1024292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2224Open in IMG/M
3300009003|Ga0102813_1190058All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta636Open in IMG/M
3300009024|Ga0102811_1152105All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta866Open in IMG/M
3300009026|Ga0102829_1143173All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta762Open in IMG/M
3300009027|Ga0102957_1243314All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M
3300009035|Ga0102958_1015954All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1951Open in IMG/M
3300009054|Ga0102826_1178921All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300009055|Ga0102905_1052763All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta810Open in IMG/M
3300009056|Ga0102860_1057778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1050Open in IMG/M
3300009057|Ga0102892_1023547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1145Open in IMG/M
3300009057|Ga0102892_1051436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria777Open in IMG/M
3300009057|Ga0102892_1076587All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta642Open in IMG/M
3300009059|Ga0102830_1096045All Organisms → cellular organisms → Eukaryota → Sar880Open in IMG/M
3300009079|Ga0102814_10039676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2645Open in IMG/M
3300009079|Ga0102814_10134669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1352Open in IMG/M
3300009080|Ga0102815_10019898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3746Open in IMG/M
3300009080|Ga0102815_10068186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1943Open in IMG/M
3300009080|Ga0102815_10287084All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta909Open in IMG/M
3300009080|Ga0102815_10683379All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta580Open in IMG/M
3300009080|Ga0102815_10829606All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta527Open in IMG/M
3300009086|Ga0102812_10027942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3210Open in IMG/M
3300009124|Ga0118687_10091866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1045Open in IMG/M
3300009129|Ga0118728_1018618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4590Open in IMG/M
3300009130|Ga0118729_1001363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria29664Open in IMG/M
3300009170|Ga0105096_10018550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3369Open in IMG/M
3300009179|Ga0115028_10277885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1112Open in IMG/M
3300009193|Ga0115551_1335648All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta656Open in IMG/M
3300009235|Ga0103857_10082299All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta641Open in IMG/M
3300009423|Ga0115548_1093112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria992Open in IMG/M
3300009426|Ga0115547_1214732All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta604Open in IMG/M
3300009432|Ga0115005_10000547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria29046Open in IMG/M
3300009432|Ga0115005_10176575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1660Open in IMG/M
3300009432|Ga0115005_10327063All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009433|Ga0115545_1000854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16202Open in IMG/M
3300009436|Ga0115008_10000550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria28421Open in IMG/M
3300009436|Ga0115008_10053469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3118Open in IMG/M
3300009441|Ga0115007_10030364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3338Open in IMG/M
3300009476|Ga0115555_1392036All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta553Open in IMG/M
3300009476|Ga0115555_1458414All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta505Open in IMG/M
3300009543|Ga0115099_10027132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4915Open in IMG/M
3300009543|Ga0115099_10041745All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta756Open in IMG/M
3300009543|Ga0115099_10075718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2040Open in IMG/M
3300009543|Ga0115099_10231598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3404Open in IMG/M
3300009543|Ga0115099_10268371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3569Open in IMG/M
3300009543|Ga0115099_10430431All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta622Open in IMG/M
3300009543|Ga0115099_10512447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2290Open in IMG/M
3300009543|Ga0115099_10614760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2105Open in IMG/M
3300009543|Ga0115099_10623420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1872Open in IMG/M
3300009543|Ga0115099_10648645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2026Open in IMG/M
3300009543|Ga0115099_10990512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2319Open in IMG/M
3300009544|Ga0115006_10214881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1698Open in IMG/M
3300009544|Ga0115006_11131511All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens698Open in IMG/M
3300009550|Ga0115013_10000463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria24701Open in IMG/M
3300009592|Ga0115101_1125873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15780Open in IMG/M
3300009592|Ga0115101_1126791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria12507Open in IMG/M
3300009592|Ga0115101_1206472All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta881Open in IMG/M
3300009592|Ga0115101_1495382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales4165Open in IMG/M
3300009593|Ga0115011_10000519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria31387Open in IMG/M
3300009593|Ga0115011_10350927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1135Open in IMG/M
3300009599|Ga0115103_1132994All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300009599|Ga0115103_1745756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4924Open in IMG/M
3300009599|Ga0115103_1828349All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta876Open in IMG/M
3300009606|Ga0115102_10111172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6838Open in IMG/M
3300009677|Ga0115104_10510335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1322Open in IMG/M
3300009741|Ga0123361_1043682All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta746Open in IMG/M
3300009747|Ga0123363_1088922All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta561Open in IMG/M
3300009747|Ga0123363_1104449All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta543Open in IMG/M
3300009756|Ga0123366_1059681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1388Open in IMG/M
3300009790|Ga0115012_11142378All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta651Open in IMG/M
3300010129|Ga0123376_1012948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales800Open in IMG/M
3300010135|Ga0123382_1112807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1202Open in IMG/M
3300010309|Ga0102890_1003110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3588Open in IMG/M
3300010309|Ga0102890_1003677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3275Open in IMG/M
3300010316|Ga0136655_1121406All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta784Open in IMG/M
3300010354|Ga0129333_10012174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8158Open in IMG/M
3300010354|Ga0129333_10377361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1258Open in IMG/M
3300010354|Ga0129333_10457537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1123Open in IMG/M
3300010370|Ga0129336_10133562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1441Open in IMG/M
3300010370|Ga0129336_10368013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria789Open in IMG/M
3300010412|Ga0136852_10480137All Organisms → cellular organisms → Eukaryota → Sar1206Open in IMG/M
3300010885|Ga0133913_10009387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria25652Open in IMG/M
3300010993|Ga0139329_100728All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1668Open in IMG/M
3300012012|Ga0153799_1029890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1053Open in IMG/M
3300012408|Ga0138265_1116537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15882Open in IMG/M
3300012408|Ga0138265_1259728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6124Open in IMG/M
3300012408|Ga0138265_1314007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7921Open in IMG/M
3300012408|Ga0138265_1418242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8752Open in IMG/M
3300012413|Ga0138258_1187746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2027Open in IMG/M
3300012413|Ga0138258_1345469All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta816Open in IMG/M
3300012415|Ga0138263_1708670All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta801Open in IMG/M
3300012416|Ga0138259_1517629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5768Open in IMG/M
3300012416|Ga0138259_1637926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3654Open in IMG/M
3300012416|Ga0138259_1814858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1659Open in IMG/M
3300012417|Ga0138262_1485724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11794Open in IMG/M
3300012418|Ga0138261_1006595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1798Open in IMG/M
3300012418|Ga0138261_1176132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15992Open in IMG/M
3300012418|Ga0138261_1623623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2721Open in IMG/M
3300012419|Ga0138260_10224194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8357Open in IMG/M
3300012419|Ga0138260_10456118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6548Open in IMG/M
3300012471|Ga0129334_1088911All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta719Open in IMG/M
3300012518|Ga0129349_1109104All Organisms → cellular organisms → Eukaryota → Sar872Open in IMG/M
3300012767|Ga0138267_1207048All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta959Open in IMG/M
3300012954|Ga0163111_10018226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5034Open in IMG/M
3300012954|Ga0163111_10042042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3515Open in IMG/M
3300012954|Ga0163111_11184945All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens745Open in IMG/M
3300012954|Ga0163111_11271216All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta721Open in IMG/M
3300012962|Ga0129335_1114838All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens794Open in IMG/M
3300012970|Ga0129338_1359444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1105Open in IMG/M
3300013110|Ga0171652_1091053All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta710Open in IMG/M
3300013115|Ga0171651_1110755All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300013372|Ga0177922_10683897All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300013791|Ga0119889_1000727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae4367Open in IMG/M
3300016787|Ga0182080_1699484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1712Open in IMG/M
3300017163|Ga0186561_100234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5883Open in IMG/M
3300017729|Ga0181396_1029257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1097Open in IMG/M
3300017753|Ga0181407_1042107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1208Open in IMG/M
3300017967|Ga0181590_10034598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4065Open in IMG/M
3300017985|Ga0181576_10661307All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta627Open in IMG/M
3300018515|Ga0192960_100017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6288Open in IMG/M
3300018515|Ga0192960_100018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6285Open in IMG/M
3300018515|Ga0192960_100022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6107Open in IMG/M
3300018515|Ga0192960_106330All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta564Open in IMG/M
3300018603|Ga0192881_1000191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3074Open in IMG/M
3300018603|Ga0192881_1028138All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta521Open in IMG/M
3300018603|Ga0192881_1028904All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta513Open in IMG/M
3300018608|Ga0193415_1014066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta678Open in IMG/M
3300018635|Ga0193376_1000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales4046Open in IMG/M
3300018635|Ga0193376_1000114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2843Open in IMG/M
3300018635|Ga0193376_1000855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1761Open in IMG/M
3300018640|Ga0188880_1022121All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta526Open in IMG/M
3300018649|Ga0192969_1000007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11963Open in IMG/M
3300018649|Ga0192969_1000012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10534Open in IMG/M
3300018683|Ga0192952_1001621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1320Open in IMG/M
3300018684|Ga0192983_1000033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4963Open in IMG/M
3300018692|Ga0192944_1000001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15901Open in IMG/M
3300018704|Ga0192954_1000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4421Open in IMG/M
3300018713|Ga0192887_1002655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1564Open in IMG/M
3300018730|Ga0192967_1068450All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta586Open in IMG/M
3300018743|Ga0193425_1000641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2409Open in IMG/M
3300018745|Ga0193000_1020087All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300018791|Ga0192950_1000143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3199Open in IMG/M
3300018791|Ga0192950_1059865All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
3300018844|Ga0193312_1000031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales4330Open in IMG/M
3300018852|Ga0193284_1043416All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta688Open in IMG/M
3300018873|Ga0193553_1000008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14297Open in IMG/M
3300018930|Ga0192955_10003890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1983Open in IMG/M
3300018930|Ga0192955_10072854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria825Open in IMG/M
3300018942|Ga0193426_10074267All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens749Open in IMG/M
3300018947|Ga0193066_10000001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11684Open in IMG/M
3300018947|Ga0193066_10106636All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta817Open in IMG/M
3300018965|Ga0193562_10006232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2029Open in IMG/M
3300018966|Ga0193293_10000081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2701Open in IMG/M
3300018974|Ga0192873_10008535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2550Open in IMG/M
3300018979|Ga0193540_10000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9325Open in IMG/M
3300018980|Ga0192961_10000120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7190Open in IMG/M
3300018980|Ga0192961_10000124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya7130Open in IMG/M
3300018980|Ga0192961_10000501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4382Open in IMG/M
3300018980|Ga0192961_10000722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3989Open in IMG/M
3300018980|Ga0192961_10001168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3568Open in IMG/M
3300018980|Ga0192961_10001752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3221Open in IMG/M
3300018980|Ga0192961_10006437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2303Open in IMG/M
3300018980|Ga0192961_10006725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2276Open in IMG/M
3300018980|Ga0192961_10007450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2210Open in IMG/M
3300018980|Ga0192961_10017338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1735Open in IMG/M
3300018980|Ga0192961_10094570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya902Open in IMG/M
3300018981|Ga0192968_10000223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6634Open in IMG/M
3300019000|Ga0192953_10000047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4397Open in IMG/M
3300019001|Ga0193034_10014376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1212Open in IMG/M
3300019009|Ga0192880_10000675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3976Open in IMG/M
3300019009|Ga0192880_10002591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2783Open in IMG/M
3300019010|Ga0193044_10000423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5463Open in IMG/M
3300019010|Ga0193044_10000910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4584Open in IMG/M
3300019010|Ga0193044_10000949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4544Open in IMG/M
3300019022|Ga0192951_10000236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales4114Open in IMG/M
3300019037|Ga0192886_10000205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3700Open in IMG/M
3300019049|Ga0193082_10000037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4625Open in IMG/M
3300019049|Ga0193082_10080892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1233Open in IMG/M
3300019099|Ga0193102_1025848All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta558Open in IMG/M
3300019100|Ga0193045_1021196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1101Open in IMG/M
3300019125|Ga0193104_1000985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2072Open in IMG/M
3300019133|Ga0193089_1006258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2231Open in IMG/M
3300019133|Ga0193089_1069175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria854Open in IMG/M
3300019191|Ga0180035_1046696All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta851Open in IMG/M
3300019191|Ga0180035_1097357All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta571Open in IMG/M
3300019198|Ga0180033_175637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6146Open in IMG/M
3300019200|Ga0180036_1005076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales14370Open in IMG/M
3300019200|Ga0180036_1026732All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta728Open in IMG/M
3300019200|Ga0180036_1030059All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta534Open in IMG/M
3300019200|Ga0180036_1038618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8703Open in IMG/M
3300019200|Ga0180036_1073432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4941Open in IMG/M
3300019201|Ga0180032_1004997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1318Open in IMG/M
3300019201|Ga0180032_1006985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14252Open in IMG/M
3300019201|Ga0180032_1057565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1200Open in IMG/M
3300019201|Ga0180032_1070408All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta830Open in IMG/M
3300019201|Ga0180032_1107635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales873Open in IMG/M
3300019201|Ga0180032_1139312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9021Open in IMG/M
3300019207|Ga0180034_1031863All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta700Open in IMG/M
3300019207|Ga0180034_1032597All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta674Open in IMG/M
3300019207|Ga0180034_1103014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1634Open in IMG/M
3300019214|Ga0180037_1033661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1898Open in IMG/M
3300019214|Ga0180037_1146406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2581Open in IMG/M
3300019214|Ga0180037_1193233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6092Open in IMG/M
3300019214|Ga0180037_1216078All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta814Open in IMG/M
3300019253|Ga0182064_1258208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6154Open in IMG/M
3300019253|Ga0182064_1267212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5149Open in IMG/M
3300019696|Ga0194017_1005147All Organisms → cellular organisms → Eukaryota → Sar1117Open in IMG/M
3300019699|Ga0193985_1020001All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens708Open in IMG/M
3300019700|Ga0194006_1008524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria988Open in IMG/M
3300019701|Ga0194015_1033863All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta597Open in IMG/M
3300019702|Ga0193997_1003403All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300019703|Ga0194021_1000013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11377Open in IMG/M
3300019703|Ga0194021_1000028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7791Open in IMG/M
3300019703|Ga0194021_1002773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1214Open in IMG/M
3300019704|Ga0193979_1010758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria909Open in IMG/M
3300019704|Ga0193979_1031900All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300019705|Ga0193981_1000593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2593Open in IMG/M
3300019706|Ga0193995_1008016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1024Open in IMG/M
3300019706|Ga0193995_1008844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae990Open in IMG/M
3300019708|Ga0194016_1007620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1094Open in IMG/M
3300019709|Ga0193967_1025280All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta667Open in IMG/M
3300019710|Ga0194009_1013031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta894Open in IMG/M
3300019711|Ga0193993_1010218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria943Open in IMG/M
3300019712|Ga0193969_1012050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria930Open in IMG/M
3300019714|Ga0193975_1031140All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta627Open in IMG/M
3300019715|Ga0193966_1006298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1093Open in IMG/M
3300019716|Ga0193984_1043456All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta579Open in IMG/M
3300019717|Ga0193972_1002950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1366Open in IMG/M
3300019718|Ga0193999_1000998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2073Open in IMG/M
3300019719|Ga0193977_1004318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1312Open in IMG/M
3300019719|Ga0193977_1013577All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta874Open in IMG/M
3300019721|Ga0194011_1000102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4636Open in IMG/M
3300019721|Ga0194011_1002953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1290Open in IMG/M
3300019725|Ga0193980_1001289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2156Open in IMG/M
3300019725|Ga0193980_1022874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria739Open in IMG/M
3300019726|Ga0193974_1000825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2297Open in IMG/M
3300019726|Ga0193974_1005179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1222Open in IMG/M
3300019726|Ga0193974_1015618All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta826Open in IMG/M
3300019727|Ga0193976_1009032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1062Open in IMG/M
3300019729|Ga0193968_1001934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1944Open in IMG/M
3300019730|Ga0194001_1012797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria865Open in IMG/M
3300019733|Ga0194013_1000250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3247Open in IMG/M
3300019733|Ga0194013_1034049All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta633Open in IMG/M
3300019734|Ga0193970_1002430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1735Open in IMG/M
3300019735|Ga0193990_1030151All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta677Open in IMG/M
3300019737|Ga0193973_1053922All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta553Open in IMG/M
3300019737|Ga0193973_1066220All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta519Open in IMG/M
3300019738|Ga0193994_1007667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1217Open in IMG/M
3300019739|Ga0194012_1028488All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta690Open in IMG/M
3300019740|Ga0193988_1002172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2162Open in IMG/M
3300019741|Ga0194020_1000217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3286Open in IMG/M
3300019743|Ga0193992_1026312All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta751Open in IMG/M
3300019743|Ga0193992_1044008All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta621Open in IMG/M
3300019744|Ga0193998_1006949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1258Open in IMG/M
3300019746|Ga0194008_1003974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1694Open in IMG/M
3300019746|Ga0194008_1024657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria810Open in IMG/M
3300019749|Ga0193983_1000961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2340Open in IMG/M
3300019750|Ga0194000_1029767All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta749Open in IMG/M
3300019750|Ga0194000_1048777All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta634Open in IMG/M
3300019750|Ga0194000_1065322All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta574Open in IMG/M
3300019752|Ga0193958_1069214All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta748Open in IMG/M
3300019753|Ga0194010_1069561All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta614Open in IMG/M
3300019755|Ga0193954_1107969All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta622Open in IMG/M
3300019759|Ga0193961_1053365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1028Open in IMG/M
3300019768|Ga0193960_1077198All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta874Open in IMG/M
3300019934|Ga0194005_102732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria739Open in IMG/M
3300019937|Ga0194022_1000014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26257Open in IMG/M
3300019937|Ga0194022_1013067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1088Open in IMG/M
3300020048|Ga0207193_1003372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27026Open in IMG/M
3300020048|Ga0207193_1027726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6699Open in IMG/M
3300020074|Ga0194113_10007146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13998Open in IMG/M
3300020159|Ga0211734_10540042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1950Open in IMG/M
3300020159|Ga0211734_10939910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26093Open in IMG/M
3300020160|Ga0211733_10699235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3150Open in IMG/M
3300020160|Ga0211733_11105483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1463Open in IMG/M
3300020161|Ga0211726_10171492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1753Open in IMG/M
3300020172|Ga0211729_10905221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3213Open in IMG/M
3300020177|Ga0181596_10001204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26507Open in IMG/M
3300020177|Ga0181596_10244985All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta751Open in IMG/M
3300020196|Ga0194124_10313730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria752Open in IMG/M
3300020205|Ga0211731_11163251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3226Open in IMG/M
3300020221|Ga0194127_10223899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1307Open in IMG/M
3300020352|Ga0211505_1121153All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens620Open in IMG/M
3300020493|Ga0208591_1006578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1795Open in IMG/M
3300020496|Ga0208230_1000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27117Open in IMG/M
3300020561|Ga0207934_1000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria21904Open in IMG/M
3300020561|Ga0207934_1043116All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta765Open in IMG/M
3300021089|Ga0206679_10415009All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta713Open in IMG/M
3300021093|Ga0194123_10018612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5583Open in IMG/M
3300021273|Ga0210340_1019543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1997Open in IMG/M
3300021282|Ga0210303_1057700All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta585Open in IMG/M
3300021284|Ga0210299_150248All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta681Open in IMG/M
3300021284|Ga0210299_151355All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta712Open in IMG/M
3300021296|Ga0210300_125381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1892Open in IMG/M
3300021303|Ga0210308_1035675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1241Open in IMG/M
3300021305|Ga0210296_1071135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4858Open in IMG/M
3300021314|Ga0210370_1061313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2270Open in IMG/M
3300021323|Ga0210295_1044240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14124Open in IMG/M
3300021328|Ga0210298_1038414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales965Open in IMG/M
3300021335|Ga0213867_1000181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria29106Open in IMG/M
3300021336|Ga0210307_1125707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2715Open in IMG/M
3300021336|Ga0210307_1344708All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta924Open in IMG/M
3300021347|Ga0213862_10237161All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta643Open in IMG/M
3300021353|Ga0206693_1211524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3227Open in IMG/M
3300021356|Ga0213858_10010933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4291Open in IMG/M
3300021364|Ga0213859_10014117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3661Open in IMG/M
3300021364|Ga0213859_10024738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2810Open in IMG/M
3300021368|Ga0213860_10000151All Organisms → cellular organisms → Bacteria27228Open in IMG/M
3300021368|Ga0213860_10001382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9846Open in IMG/M
3300021368|Ga0213860_10001545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales9347Open in IMG/M
3300021371|Ga0213863_10000621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26633Open in IMG/M
3300021371|Ga0213863_10005692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8204Open in IMG/M
3300021371|Ga0213863_10080519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1599Open in IMG/M
3300021371|Ga0213863_10121181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1224Open in IMG/M
3300021371|Ga0213863_10312986All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta654Open in IMG/M
3300021373|Ga0213865_10000488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27098Open in IMG/M
3300021378|Ga0213861_10001223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22745Open in IMG/M
3300021379|Ga0213864_10001327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11184Open in IMG/M
3300021379|Ga0213864_10025366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2730Open in IMG/M
3300021379|Ga0213864_10169679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1105Open in IMG/M
3300021379|Ga0213864_10577938All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta557Open in IMG/M
3300021425|Ga0213866_10003710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10254Open in IMG/M
3300021465|Ga0193947_1004223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2313Open in IMG/M
3300021497|Ga0193945_1031560All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta676Open in IMG/M
3300021501|Ga0193948_1037005All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta662Open in IMG/M
3300021847|Ga0210305_1141344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2919Open in IMG/M
3300021849|Ga0210304_1102844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria971Open in IMG/M
3300021957|Ga0222717_10000776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26982Open in IMG/M
3300021957|Ga0222717_10001926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16491Open in IMG/M
3300021957|Ga0222717_10005914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales8811Open in IMG/M
3300021957|Ga0222717_10026245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3869Open in IMG/M
3300021957|Ga0222717_10076289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2127Open in IMG/M
3300021958|Ga0222718_10122165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1504Open in IMG/M
3300021958|Ga0222718_10206505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1069Open in IMG/M
3300021958|Ga0222718_10320910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria798Open in IMG/M
3300021959|Ga0222716_10030925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3902Open in IMG/M
3300021960|Ga0222715_10014129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6206Open in IMG/M
3300021961|Ga0222714_10424728All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta697Open in IMG/M
3300021962|Ga0222713_10362351All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta903Open in IMG/M
3300022202|Ga0224498_10036857All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300022206|Ga0224499_10285790All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta558Open in IMG/M
3300022217|Ga0224514_10010853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2850Open in IMG/M
3300022223|Ga0224501_10274740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria880Open in IMG/M
3300022223|Ga0224501_10475864All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta603Open in IMG/M
3300022309|Ga0224510_10000620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26752Open in IMG/M
3300022367|Ga0210312_101443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1559Open in IMG/M
3300022367|Ga0210312_116975All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta569Open in IMG/M
3300022369|Ga0210310_1035745All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta527Open in IMG/M
3300022372|Ga0210293_101779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2056Open in IMG/M
3300022372|Ga0210293_109268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales987Open in IMG/M
3300022374|Ga0210311_1017210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales870Open in IMG/M
3300022374|Ga0210311_1029153All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta668Open in IMG/M
3300022375|Ga0210313_1010857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1051Open in IMG/M
3300022375|Ga0210313_1027887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta669Open in IMG/M
(restricted) 3300022913|Ga0233404_10000040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26616Open in IMG/M
(restricted) 3300023112|Ga0233411_10105585All Organisms → cellular organisms → Bacteria903Open in IMG/M
(restricted) 3300023114|Ga0233405_10000008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria19201Open in IMG/M
(restricted) 3300023114|Ga0233405_10031276All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta789Open in IMG/M
(restricted) 3300023276|Ga0233410_10167419All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta699Open in IMG/M
(restricted) 3300024062|Ga0255039_10000702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales10898Open in IMG/M
(restricted) 3300024062|Ga0255039_10037350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1797Open in IMG/M
3300024343|Ga0244777_10000315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria38955Open in IMG/M
3300024343|Ga0244777_10001676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15704Open in IMG/M
3300024343|Ga0244777_10002081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13996Open in IMG/M
3300024343|Ga0244777_10438216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria809Open in IMG/M
3300024346|Ga0244775_10110005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2339Open in IMG/M
3300024346|Ga0244775_10113517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2299Open in IMG/M
3300024346|Ga0244775_10295763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1343Open in IMG/M
3300024346|Ga0244775_10580039All Organisms → cellular organisms → Eukaryota → Sar911Open in IMG/M
3300024346|Ga0244775_10886310All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta709Open in IMG/M
3300024348|Ga0244776_10579122All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens711Open in IMG/M
3300024534|Ga0256357_1045940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria849Open in IMG/M
3300024544|Ga0255294_1057561All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta693Open in IMG/M
3300024852|Ga0255295_1074873All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M
3300025684|Ga0209652_1008738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6301Open in IMG/M
3300025684|Ga0209652_1047742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1580Open in IMG/M
3300025732|Ga0208784_1083767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria960Open in IMG/M
3300025732|Ga0208784_1219339All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300025821|Ga0209600_1022467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2487Open in IMG/M
3300025840|Ga0208917_1002393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9055Open in IMG/M
3300025840|Ga0208917_1034689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2074Open in IMG/M
3300025840|Ga0208917_1164038All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta763Open in IMG/M
3300025848|Ga0208005_1000087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria38949Open in IMG/M
3300025848|Ga0208005_1029695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1685Open in IMG/M
3300025883|Ga0209456_10009463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4318Open in IMG/M
3300025894|Ga0209335_10320466All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta652Open in IMG/M
3300026106|Ga0209927_1020134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales939Open in IMG/M
3300026123|Ga0209955_1012083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2099Open in IMG/M
3300026123|Ga0209955_1015131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1829Open in IMG/M
3300026125|Ga0209962_1006001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2397Open in IMG/M
3300026126|Ga0209957_1012046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1881Open in IMG/M
3300026133|Ga0209940_1012198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1402Open in IMG/M
3300026563|Ga0256355_1023420All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300026931|Ga0209850_1000183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6663Open in IMG/M
3300027160|Ga0255198_1044465All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta799Open in IMG/M
3300027196|Ga0208438_1066560All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta588Open in IMG/M
3300027203|Ga0208925_100033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8916Open in IMG/M
3300027203|Ga0208925_100139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4726Open in IMG/M
3300027204|Ga0208924_114030All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta644Open in IMG/M
3300027212|Ga0208554_1078351All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300027215|Ga0208166_1001604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2800Open in IMG/M
3300027216|Ga0208677_1017466All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300027218|Ga0208165_1014432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1194Open in IMG/M
3300027223|Ga0208169_1010766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1799Open in IMG/M
3300027225|Ga0208025_1000852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6883Open in IMG/M
3300027228|Ga0208308_1021011All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta885Open in IMG/M
3300027230|Ga0208171_1000072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11478Open in IMG/M
3300027230|Ga0208171_1000126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9274Open in IMG/M
3300027230|Ga0208171_1027471All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta553Open in IMG/M
3300027235|Ga0208804_1001485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3261Open in IMG/M
3300027235|Ga0208804_1004736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1618Open in IMG/M
3300027238|Ga0208808_1043545All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta540Open in IMG/M
3300027240|Ga0208444_1028017All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta775Open in IMG/M
3300027245|Ga0208445_1024207All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta627Open in IMG/M
3300027246|Ga0208931_1029700All Organisms → cellular organisms → Eukaryota → Sar1102Open in IMG/M
3300027248|Ga0208176_1001582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3751Open in IMG/M
3300027251|Ga0208809_1054481All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta673Open in IMG/M
3300027253|Ga0208680_1081720All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300027308|Ga0208796_1038190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1110Open in IMG/M
3300027308|Ga0208796_1055412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria878Open in IMG/M
3300027416|Ga0207994_1000665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya7207Open in IMG/M
3300027416|Ga0207994_1011256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1813Open in IMG/M
3300027501|Ga0208948_1040808All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300027506|Ga0208973_1080939All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens766Open in IMG/M
3300027572|Ga0208964_1122852All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta555Open in IMG/M
3300027673|Ga0209278_1000358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39917Open in IMG/M
3300027683|Ga0209392_1097572All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta937Open in IMG/M
3300027714|Ga0209815_1007711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5365Open in IMG/M
3300027714|Ga0209815_1253251All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta530Open in IMG/M
(restricted) 3300027730|Ga0247833_1014505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6646Open in IMG/M
3300027751|Ga0208304_10011782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3647Open in IMG/M
3300027753|Ga0208305_10004279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya6325Open in IMG/M
3300027753|Ga0208305_10010536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3880Open in IMG/M
3300027753|Ga0208305_10099035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1093Open in IMG/M
3300027757|Ga0208671_10022708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2355Open in IMG/M
3300027757|Ga0208671_10034998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1878Open in IMG/M
3300027757|Ga0208671_10047691All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300027757|Ga0208671_10361268All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta508Open in IMG/M
3300027776|Ga0209277_10000299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria25659Open in IMG/M
3300027781|Ga0209175_10249841All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens753Open in IMG/M
3300027786|Ga0209812_10000756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26629Open in IMG/M
3300027789|Ga0209174_10131056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1155Open in IMG/M
3300027810|Ga0209302_10000886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria17318Open in IMG/M
3300027810|Ga0209302_10016266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4342Open in IMG/M
3300027833|Ga0209092_10057392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2390Open in IMG/M
(restricted) 3300027837|Ga0255041_10147492All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens808Open in IMG/M
3300027849|Ga0209712_10000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria25135Open in IMG/M
3300027849|Ga0209712_10150228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1333Open in IMG/M
3300027883|Ga0209713_10037851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3275Open in IMG/M
3300027885|Ga0209450_10000295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria26919Open in IMG/M
3300027890|Ga0209496_10357616All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta747Open in IMG/M
3300027899|Ga0209668_10001486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10077Open in IMG/M
3300027899|Ga0209668_10002022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8852Open in IMG/M
3300027906|Ga0209404_10002333All Organisms → cellular organisms → Bacteria11840Open in IMG/M
(restricted) 3300027977|Ga0247834_1211196All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens725Open in IMG/M
3300028113|Ga0255234_1176450All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta560Open in IMG/M
3300028267|Ga0256358_1051594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria811Open in IMG/M
3300028329|Ga0210315_1016609All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta903Open in IMG/M
3300028524|Ga0210314_109840All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta821Open in IMG/M
3300028647|Ga0272412_1133065All Organisms → cellular organisms → Eukaryota1053Open in IMG/M
3300031589|Ga0307996_1000066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria28446Open in IMG/M
3300031589|Ga0307996_1000838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8234Open in IMG/M
3300031658|Ga0307984_1000734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14063Open in IMG/M
3300031758|Ga0315907_10087296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae2684Open in IMG/M
3300031758|Ga0315907_10996799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta605Open in IMG/M
3300031784|Ga0315899_10200091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2014Open in IMG/M
3300031786|Ga0315908_10424681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1112Open in IMG/M
3300031851|Ga0315320_10102580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2185Open in IMG/M
3300031963|Ga0315901_10491627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales959Open in IMG/M
3300032073|Ga0315315_10573970All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300032092|Ga0315905_10246544All Organisms → cellular organisms → Eukaryota → Sar1736Open in IMG/M
3300032092|Ga0315905_11370783All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta564Open in IMG/M
3300032136|Ga0316201_11217594All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta629Open in IMG/M
3300032150|Ga0314779_1002515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1489Open in IMG/M
3300032258|Ga0316191_10657887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria761Open in IMG/M
3300032260|Ga0316192_10425114All Organisms → cellular organisms → Eukaryota → Sar908Open in IMG/M
3300032263|Ga0316195_10017766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3609Open in IMG/M
3300032272|Ga0316189_10000912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria29567Open in IMG/M
3300032276|Ga0316188_10016550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3473Open in IMG/M
3300032277|Ga0316202_10120122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1218Open in IMG/M
3300032373|Ga0316204_10731468All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta715Open in IMG/M
3300033418|Ga0316625_100068971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1833Open in IMG/M
3300033418|Ga0316625_101547376All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta630Open in IMG/M
3300033418|Ga0316625_101783470All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta596Open in IMG/M
3300033483|Ga0316629_11419878All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta563Open in IMG/M
3300033521|Ga0316616_102856956All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta651Open in IMG/M
3300033978|Ga0334977_0032598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2948Open in IMG/M
3300033984|Ga0334989_0000257Not Available27006Open in IMG/M
3300034019|Ga0334998_0067034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2454Open in IMG/M
3300034019|Ga0334998_0129628All Organisms → cellular organisms → Eukaryota → Sar1638Open in IMG/M
3300034019|Ga0334998_0218228All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1175Open in IMG/M
3300034021|Ga0335004_0121250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1723Open in IMG/M
3300034060|Ga0334983_0201073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1236Open in IMG/M
3300034066|Ga0335019_0132840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1651Open in IMG/M
3300034066|Ga0335019_0668040All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta600Open in IMG/M
3300034072|Ga0310127_189305All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta775Open in IMG/M
3300034107|Ga0335037_0000364Not Available28568Open in IMG/M
3300034107|Ga0335037_0290123All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta891Open in IMG/M
3300034111|Ga0335063_0259319All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta943Open in IMG/M
3300034200|Ga0335065_0611265All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta635Open in IMG/M
3300034355|Ga0335039_0559213All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta565Open in IMG/M
3300034357|Ga0335064_0028777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2989Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine22.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.83%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment8.60%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.94%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.48%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.48%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.75%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.60%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.46%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.02%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.02%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.02%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.02%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.02%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.87%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.87%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.87%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.87%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.73%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.73%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.73%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.58%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.58%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.58%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.58%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.58%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.58%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.44%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.44%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.29%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.29%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.29%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.29%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.29%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.29%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.29%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.15%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.15%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.15%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.15%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.15%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.15%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment0.15%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.15%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.15%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.15%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.15%
Bioluminescent BayEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay0.15%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.15%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.15%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.15%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.15%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.15%
WastewaterEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater0.15%
Marine SedimentEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment0.15%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352005Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000126Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5mEnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000422Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A SedimentEnvironmentalOpen in IMG/M
3300002153Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M MetagenomeEnvironmentalOpen in IMG/M
3300002396Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002404Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002447Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion MetagenomeEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003247Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10EnvironmentalOpen in IMG/M
3300003265Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10EnvironmentalOpen in IMG/M
3300003268Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10EnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003428Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20EnvironmentalOpen in IMG/M
3300003549Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_08_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003554Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003566Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_07_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003691Combined assembly of microbial communities in oil-polluted sediment from the Gulf of MexicoEnvironmentalOpen in IMG/M
3300003712Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005824Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300005990Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007102Combined Assembly of Marine Sediment Inoculum and EnrichmentsEngineeredOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007228Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007232Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007237Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 A RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007319Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007621Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007784Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MGEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008510Microbial Communities in Water bodies, Singapore - Site RAEnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010993ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp)EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013110Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300013791Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_EW_metaEngineeredOpen in IMG/M
3300016787Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017163Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 661 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1410)Host-AssociatedOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018640Metatranscriptome of marine microbial communities from Baltic Sea - GS859_ls5EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019198Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019696Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MGEnvironmentalOpen in IMG/M
3300019699Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MGEnvironmentalOpen in IMG/M
3300019700Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MGEnvironmentalOpen in IMG/M
3300019701Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MGEnvironmentalOpen in IMG/M
3300019702Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_3-4_MGEnvironmentalOpen in IMG/M
3300019703Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MGEnvironmentalOpen in IMG/M
3300019704Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_0-1_MGEnvironmentalOpen in IMG/M
3300019705Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_2-3_MGEnvironmentalOpen in IMG/M
3300019706Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_1-2_MGEnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019709Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_3-4_MGEnvironmentalOpen in IMG/M
3300019710Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MGEnvironmentalOpen in IMG/M
3300019711Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MGEnvironmentalOpen in IMG/M
3300019712Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MGEnvironmentalOpen in IMG/M
3300019714Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MGEnvironmentalOpen in IMG/M
3300019715Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MGEnvironmentalOpen in IMG/M
3300019716Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_0-1_MGEnvironmentalOpen in IMG/M
3300019717Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019719Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_4-5_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019725Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_1-2_MGEnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300019727Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_3-4_MGEnvironmentalOpen in IMG/M
3300019729Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MGEnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019733Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MGEnvironmentalOpen in IMG/M
3300019734Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MGEnvironmentalOpen in IMG/M
3300019735Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_1-2_MGEnvironmentalOpen in IMG/M
3300019737Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MGEnvironmentalOpen in IMG/M
3300019738Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MGEnvironmentalOpen in IMG/M
3300019739Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MGEnvironmentalOpen in IMG/M
3300019740Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_4-5_MGEnvironmentalOpen in IMG/M
3300019741Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MGEnvironmentalOpen in IMG/M
3300019743Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_3-4_MGEnvironmentalOpen in IMG/M
3300019744Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MGEnvironmentalOpen in IMG/M
3300019746Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_4-5_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300019752Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_1_MGEnvironmentalOpen in IMG/M
3300019753Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MGEnvironmentalOpen in IMG/M
3300019755Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_5_MGEnvironmentalOpen in IMG/M
3300019759Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_4_MGEnvironmentalOpen in IMG/M
3300019768Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_3_MGEnvironmentalOpen in IMG/M
3300019934Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_1-2_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020493Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020496Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021273Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021296Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R881 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021314Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021328Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R877 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021465Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MGEnvironmentalOpen in IMG/M
3300021497Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_0-1_MGEnvironmentalOpen in IMG/M
3300021501Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_1-2_MGEnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024534Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025883Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026106Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026126Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026133Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026563Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026931Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027160Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027203Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027204Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027215Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027225Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027228Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027230Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027238Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027240Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027245Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027501Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027673Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes)EngineeredOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028267Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028524Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22001047872199352005FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
SA_S2_NOR13_50mDRAFT_1000004183300000120MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSSKSQNLEPGEYITIKLAYGSSVSQEKK*
BS_KBA_SWE12_21mDRAFT_10000204313300000124MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSTNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
BS_KBA_SWE12_21mDRAFT_1000183823300000124MarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
BS_KBA_SWE12_21mDRAFT_1000681433300000124MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK*
BS_KBA_SWE12_21mDRAFT_1000736863300000124MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQDLEPGEYITIKLAYGSSVS*
BS_KBA_SWE12_21mDRAFT_1003515413300000124MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK*
BS_KBB_SWE26_205mDRAFT_101938023300000126MarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSXPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
SA_S1_NOR05_45mDRAFT_1011670423300000127MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQNSQNLEPGEYITIKLAY
SA_S1_NOR08_45mDRAFT_1022605113300000128MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
KGI_S1_ANT02_95mDRAFT_1013439923300000136MarineHLNHTLEPIKKQTVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
TDF_OR_ARG05_123mDRAFT_103147733300000242MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSSKSQNLEPGEYITIKLAYGSNVSQEKK*
BB_Man_A_Liq_inBBDRAFT_101043923300000422Bioluminescent BayMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK*
JGI24540J26637_1001724133300002153MarineLSLQEHLNHMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK*
B570J29629_102182713300002396FreshwaterKKRNVKEKLTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
B570J29591_100006663300002404FreshwaterLFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
JGI24768J34885_1002556843300002447Freshwater And SedimentMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKX*
B570J40625_100004039153300002835FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
JGI26116J46587_102247423300003247MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
JGI26118J46590_102043923300003265MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLXLQSVXFKHFYYVRDDXXYLLKSNPIXRXFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGE
JGI26118J46590_102208913300003265MarineLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNISQEKK*
JGI26115J46592_104130913300003268MarineFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
JGI26081J50195_101090133300003346MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILXSVQFKHFYYVRDDISYLLKSNPIERDFLLQAXYSIVISLQXNLSINFFDMWIYXVYINKVXSHNKFMNXKSQNLEADEYITIKIAYGFNVSQEXK*
JGI26111J50215_102689213300003428MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0008452J51689_11175913300003549SeawaterVSLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0008451J51688_10504363300003554SeawaterLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0008455J51687_101617313300003566SeawaterEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
JGI26082J51739_1002633633300003617MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
JGI26083J51738_1004415723300003621MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQAXYSIVISLQXNLSINFFDMWIYXVYINKVXSHNKFMNXKSQNLEADEYITIKIAYGFNVSQEXK*
Ga0008458J53046_10513663300003677SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNISQEKK*
Ga0008456_103337933300003682SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK*
JT63_100274633300003691Marine SedimentMARLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0008276_10514033300003712MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEA
Ga0031658_100035323300003860Freshwater Lake SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYISKVSSHNKFMNQKSENLETGEYITIKLAYGNSVFQEKK*
Ga0031658_100252963300003860Freshwater Lake SedimentMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
JGI26437J51864_10000126243300003910Freshwater Lake SedimentMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQXVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0055584_10171711813300004097Pelagic MarineMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLEPDEYITIKLAYGSSVPQEKK*
Ga0055584_10212474013300004097Pelagic MarineMPRVELTLQFPENFQVKTFNVKSEKKLSPLAKSILQSFRYKHFYYVRDDITYLLKSNPFERDLLLQLLHSTVIFLQNNHCVNFFDIWVYEVYINEVPEFNHFINKKCQNLESSDYITIKLAYQIKSPKEKVEIPW*
Ga0071350_1000053153300005069FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN*
Ga0068884_157066813300005417Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSS
Ga0068879_168614723300005420Freshwater LakeLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGEYITIKLAYGSSVSQEKK*
Ga0068876_1002588933300005527Freshwater LakeLFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0068872_1073228313300005528Freshwater LakeNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK*
Ga0049084_10000053163300005585Freshwater LenticLFLRERLNHILKPIKKQNVKEKLIMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0078117_1000266163300005758Lake WaterMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0078117_100030383300005758Lake WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYKKYQNLEPGEYITIKLAYGVNTSQDKK*
Ga0079957_103023163300005805LakeMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFLLQTLFSIAISLQNNLSIDFFDMWIYEIYLTKVSNPNKFIKEVYQHKEFNEYITIKLAYKIDSPKEKKKTYK*
Ga0079957_109165823300005805LakeMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0074474_138624913300005824Sediment (Intertidal)MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQTSENLEPGEYITIKLAYGNNVSQEKK*
Ga0074471_10334037143300005831Sediment (Intertidal)LFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN*
Ga0074472_1062714123300005833Sediment (Intertidal)MARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMRQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0070725_1032834223300005920Marine SedimentHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS*
Ga0073913_10000038313300005940SandMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK*
Ga0070743_10001553173300005941EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0070742_1000236953300005942EstuarineLFLHEHLNHILRQIKKQNVKENLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0070742_1002078143300005942EstuarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQK
Ga0073926_1000034573300005943SandLFLQEHLDHILRPIKKQNVKEKRNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK*
Ga0075157_10000579323300005961Wastewater EffluentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKKSSQNKELDEYITIKLAYGINTSQEKKIIF*
Ga0075158_1019863223300005987Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGVNTSQEKK*
Ga0075160_1033179913300005988Wastewater EffluentFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGVNTSQEKK*
Ga0075154_10000961153300005989Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKANPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFIDKKNQNLEPGEYITIKLAYGVNTSQEKK*
Ga0073921_110522413300005990SandKLNMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0075441_10000391303300006164MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWIYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK*
Ga0075441_1000314153300006164MarineMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDMWVYEVYVNKIPNFNKFMNQNQQNLEPCEYITIKLAYSVNLSNEKK*
Ga0075501_108337363300006355AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPVEYITIKLAYGSSVSQEKK*
Ga0075502_100133223300006357AqueousMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSISFFDIWIYEIYINKVSTHNKFMRKKSQNLESDEYITIKLAYGSSVS*
Ga0075502_101125723300006357AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075502_106521113300006357AqueousLTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0075483_130159923300006373AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSSHNKFMNEKSQNLETDEYITIKLAYGFNVSQEKK*
Ga0075512_106285763300006374AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0075490_131099313300006375AqueousMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEP
Ga0075498_105138663300006378AqueousMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYFLKSNPTEKDFLLEALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNEKSENLETDEYITIKLAYGFNVSQEKK*
Ga0075494_132622423300006382AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075504_104923523300006383AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMGQKSQNLESGEYITIKLAYGSSGSQEKK*
Ga0075504_105764723300006383AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0075516_142682723300006384AqueousMACSNRGELTLKFPECFHIKTFNIQSEKILSPLAKSILQSLQFKHFYYVRDDIHYLLKSYPMERDFLLQALYSIVISLQNNFSINFFDMWIYEIYITKVSKPNKFLKQTYQYKGFDEYITIKLAYNISPEKK*
Ga0075509_102081223300006390AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEK
Ga0075517_153547823300006393AqueousMACSNRGELTLKFPECFHIKTFNIKSEKIVSPLVKSILQSLQFKHFYYVRDDIHYLLKSYPMERDFLLQALYSIVISLQNNFSINFFDMWIYEIYITKVSKPNKFLKQTYQYKGFDEYITIKLAYNISPEKK*
Ga0075492_105395763300006394AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075492_154379723300006394AqueousMARLELTLNFPKSFQIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNRNSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075493_105835113300006396AqueousNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0075488_157155463300006397AqueousMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQALYSIVISLQNNLCINFFDMWVYEVYINKVPNFNKFINQNLQQLEPEEYVTIKLAYSVNRFNEKNNIS*
Ga0075488_164146113300006397AqueousMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWVYEVYINKVSRHNKFMNEKSQNLEADEYITIKI
Ga0075495_104888453300006399AqueousLFLHEHLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0075511_176600113300006402AqueousKKQNVKEKLTMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0070744_1000996453300006484EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075505_100624823300006571AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS*
Ga0075505_103361963300006571AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFINDKSQNLEQGEYITIKLAYGSSASQEKK*
Ga0075505_141725423300006571AqueousMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQALYSIVISLQNNLCINFFDMWVYEVYINKVPNFNKFINQNLQQLEPE
Ga0075505_148912413300006571AqueousMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLLQALYSIVISLQNNFSINFFDMWVYEIYITKISNSNKFLRKTYQNKEFDEYITIK
Ga0075471_1001117653300006641AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0075467_1007164433300006803AqueousLFLQEHLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075464_1101624713300006805AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITI
Ga0075477_1016621823300006869AqueousLFLHEHSNHTLRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0075477_1025872123300006869AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVS*
Ga0075475_1000500843300006874AqueousMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLLQALYSIVISLQNNFSINFFDMWVYEIYITKISNSNKFLRKTYQNKEFDEYITIKLAYNISHDKK*
Ga0075475_1004305823300006874AqueousLFLHEHSNHTLRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075473_1015549833300006875AqueousLNMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICLQNNLSVNFFDMWIYEIYITKISTPNKFLKKSSQNKEFDEYITIKLAYNIL*
Ga0075472_10000164153300006917AqueousLFLREHLNHILRLIKKQDVKEKLNMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYFLKSNPTEKDFLLEALYSIVISLQNNLSINFFDIWVYEIYINKVSHYNKFIKEKYHNLEPDEYLTIKVAYGIPIFQEKK*
Ga0075472_1005991733300006917AqueousMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSHPNKFINQKSQNLEQGEYITIKLAYGINVSQEK*
Ga0075472_1010653533300006917AqueousMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICLQNNLSVNFFDMWIYEIYITKISTPNKFLKKSSQNKEFDEYITIKLAYNIL*
Ga0102541_145177033300007102Marine SedimentLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0102976_105375733300007169Freshwater LakeLFLHEHLDHILRLIKKQNVKEKRNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0103958_105429843300007212Freshwater LakeLFLHEHLDHILKPIKKQNVKEKRNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVLDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSENLEAGEYITIKLAYGSSISQEKK*
Ga0103959_125568543300007214Freshwater LakeLFLHEHLDHILKPIKKQNVKEKRNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSENLEAGEYITIKLAYGSSISQEKK*
Ga0075175_1051922233300007228Wastewater EffluentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0075175_139724713300007228Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNNNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK*
Ga0075179_107545513300007230Wastewater EffluentKKLNMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKKSSQNKELDEYITIKLAYGINTSQEKKIIF*
Ga0075179_109079433300007230Wastewater EffluentMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0075183_1011302733300007232Wastewater EffluentMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYG
Ga0075463_1002583333300007236AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS*
Ga0075177_150094923300007237Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK*
Ga0075170_156775033300007241Wastewater EffluentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKKSSQNKELDEYITIKLAYGINTSQEKKNNILIFIFINFKSIQKILRKL*
Ga0075167_1100375713300007244Wastewater EffluentMARLELTLNFPKRFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0075182_1010158523300007253Wastewater EffluentMARLELTLNFPKRFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLKSHPMERDFLLQVLFSIAIYLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0075182_1130509513300007253Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGVNT
Ga0102691_148164323300007319Freshwater LakeMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNL
Ga0102853_101033933300007543EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0102873_112036623300007545EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0102880_107700723300007550EstuarineEHLNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0102881_101995643300007551EstuarineIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0102881_102986243300007551EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102881_108144313300007551EstuarineNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102818_1000704113300007552EstuarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102817_105906613300007555EstuarineTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102821_103255123300007557EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102821_114391823300007557EstuarineHLNHILRQIKKQNVKEKINMARLELTLNFPKDFQIKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN*
Ga0102822_114226023300007558EstuarineELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0102828_105104533300007559EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGS
Ga0102828_110347223300007559EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGS
Ga0102913_112595723300007560EstuarineNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0102916_100247113300007585EstuarineNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102918_100124133300007593EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102872_120950323300007621EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPG
Ga0102948_101265443300007623WaterMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102948_102626233300007623WaterMARLELTLNFPKSFYVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSTNFFDIWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102948_103452333300007623WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSREKK*
Ga0102895_106262013300007629EstuarineRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0102903_116733123300007630EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102856_100819633300007636EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102906_110333823300007637EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102906_110608223300007637EstuarineARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0102902_100817723300007644EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK*
Ga0102868_100528823300007653EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102866_107721813300007661EstuarineNLFLHEHLNLILSRIKKQNVKEKLSMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS*
Ga0102866_121202823300007661EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIK
Ga0102908_100587243300007665EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS*
Ga0102910_102008613300007667EstuarineQNVKEKRNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102910_107470223300007667EstuarineSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102824_115996713300007681EstuarineSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0102823_105316023300007692EstuarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR*
Ga0102899_115109923300007706EstuarineLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102859_102689633300007708EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102827_100023683300007715EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK*
Ga0102852_100038663300007718EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLMLQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102951_100920963300007725WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK*
Ga0102955_100459433300007784SoilMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK*
Ga0105740_100151353300007955Estuary WaterMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102904_100709523300007981EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102904_101753413300007981EstuarineRLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102904_102470733300007981EstuarineMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSQNSQNLEPGEYLTIKLAYGSSIS*
Ga0102922_124673613300008021EstuarineNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102893_111419223300008052EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0114347_112241813300008114Freshwater, PlanktonMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSEKKLSPLAKLILQSVQ
Ga0114351_107796753300008117Freshwater, PlanktonNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK*
Ga0114351_109900943300008117Freshwater, PlanktonMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTDNKFMSQKSENLESGEYITIKL
Ga0114351_129997613300008117Freshwater, PlanktonNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK*
Ga0114354_100616563300008119Freshwater, PlanktonMARLELTLNFPKSFHLKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0114354_104262413300008119Freshwater, PlanktonPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK*
Ga0114354_109972623300008119Freshwater, PlanktonMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYISKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK*
Ga0114355_117447123300008120Freshwater, PlanktonMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQAFYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK*
Ga0114840_100032333300008258Freshwater, PlanktonMGRLELTLNFPKSFHIKTFNVKTEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK*
Ga0114840_105600723300008258Freshwater, PlanktonMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNL
Ga0110928_100804133300008510Water BodiesMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESNQNKEFDEYITIKLAYGINTSQEKK*
Ga0102891_108522623300008950EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102887_116409023300008961EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0102888_100720233300008995EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102888_104694723300008995EstuarineFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102888_112475523300008995EstuarineMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102816_116079523300008999EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102816_131147213300008999EstuarineFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK*
Ga0102960_132025113300009000Pond WaterVNLFLHEHLNHILRQIKKQNVKEKQNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSERSQNLEPGEYITIKLAYGSSVS*
Ga0102963_132237613300009001Pond WaterSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK*
Ga0102963_143581513300009001Pond WaterKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0102810_110380713300009002EstuarineLTLNFPKSFNIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK*
Ga0102813_102429233300009003EstuarineMARLELTLNFPKRFHIKTFNVKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLAVNFFDMWIYEIYITKVSNVNKFLRKSNQKKEFDEYITIKLAYGINISQEKK*
Ga0102813_119005823300009003EstuarineFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102811_115210523300009024EstuarineLTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0102829_114317323300009026EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPNERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK*
Ga0102957_124331423300009027Pond WaterMARVELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0102958_101595413300009035SoilRQIKKQNVKEKQNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK*
Ga0102826_117892113300009054EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLE
Ga0102905_105276323300009055EstuarineMGKRKKRKAELTLRFPENFQLATFNIKYENKLSPLAKFILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLSVDFFDIWIYEVYINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY*
Ga0102860_105777823300009056EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKN*
Ga0102892_102354733300009057EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVNSLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102892_105143613300009057EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMSQKSQNLEPG
Ga0102892_107658713300009057EstuarineVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0102830_109604533300009059EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNL
Ga0102814_1003967653300009079EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYISIKLAYGSSISQEKK*
Ga0102814_1013466933300009079EstuarineNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR*
Ga0102815_1001989853300009080EstuarineMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIYMTKISTPNKFLKKNSQNKEFDEYITIKLAYNIFQEKK*
Ga0102815_1006818633300009080EstuarineMACTSRGELTLKFPKNFHIKTFNVKSEKILSPLAKSILQSVQFKHFYYVRDDLYYLLKSEPIERDFLLQALYSIVLSLQNNLSINFFDMWVYEIYITKISNPNKFLRQIYQNKEFDEYITIKLAYNISQEKK*
Ga0102815_1028708413300009080EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102815_1068337913300009080EstuarineHLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK*
Ga0102815_1082960613300009080EstuarineVSLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK*
Ga0102812_1002794283300009086EstuarinePKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK*
Ga0118687_1009186623300009124SedimentMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK*
Ga0118728_101861873300009129MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNDKSQNLEADEYITIKIAYGFNVSQERK*
Ga0118729_1001363153300009130MarineMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ*
Ga0105096_1001855053300009170Freshwater SedimentMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSENIEPGEYITIKLAYGSSVSQEKK*
Ga0115028_1027788523300009179WetlandMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSVSQEKK*
Ga0115551_133564813300009193Pelagic MarineLAISLVNLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK*
Ga0103857_1008229913300009235River WaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPTERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSHHNKFMSQKSENLEPGEYITIKLAY*
Ga0115548_109311223300009423Pelagic MarineMARLELTLNFPKRFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115547_121473223300009426Pelagic MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQE
Ga0115005_10000547153300009432MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPIERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRFNEKK*
Ga0115005_1017657533300009432MarineMTRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115005_1032706323300009432MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTENKFMSSKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115545_1000854263300009433Pelagic MarineMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSLKFKHFYYIRDDIAYLLKSNPVERDFLLQAFYSIILSLQNNLSVNFFDMWIYEIYITTVPANNKFLNEKPQSLELDEYITIKLAYETSVS*
Ga0115008_10000550153300009436MarineMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK*
Ga0115008_1005346963300009436MarineMARLELTLNFPKSFQVKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDLSYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNRKHQNLEPGEYITIKLAYGSSVFQEKK*
Ga0115007_1003036413300009441MarineKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115555_139203613300009476Pelagic MarineKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK*
Ga0115555_145841413300009476Pelagic MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSPKSQNLEPDEYITIKLAYGSSVSQEKK*
Ga0115099_1002713263300009543MarineMVRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKKIIYHY*
Ga0115099_1004174513300009543MarineTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115099_1007571853300009543MarineMGKRKKRKTELTLRFPRNFQCATFNIKSENKLSPLAKFVLQGMQFKHFYYARDDIFYLLNSNPIEQDFLLQALYSISISLQNNLSVDFFDIWISEVHINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY*
Ga0115099_1023159863300009543MarineMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK*
Ga0115099_1026837123300009543MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115099_1043043113300009543MarineKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0115099_1051244723300009543MarineMSKQIKKYNVNKKRKKPRLELTLNFPKNFQIKTFNVKAEKKLSPLAKLILQSVQFKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQASQNLESSEYITIKLAYGKSGGFHEKK*
Ga0115099_1061476033300009543MarineMARLELTLNFPKSFQIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYVNKVSTHNKFMNRNSQNLEPGEYITIKLAYGSSVSQEKR*
Ga0115099_1062342023300009543MarineMAGLELTLNFPESFHIKTFNLKPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVNNRFLNEESQSLESDKYITIKLAYETSVS*
Ga0115099_1064864523300009543MarineMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQKKK*
Ga0115099_1099051223300009543MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSQNSQNLEPGEYLTIKLAYGNSIS*
Ga0115006_1021488133300009544MarineMAGLELTLNFPESFHIKTFNLKPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVNNRFLNEKSQSLESDKYITIKLAYETSVS*
Ga0115006_1113151123300009544MarineFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSSKSQNLEPGEYITIKLAYGSSLSQENK*
Ga0115013_1000046373300009550MarineMGKRKTELTLRFPKNFQRVTFNIKSENKLSPLAKLILQGMQFKHFYYARDDIFYLLNSNPIEQEFLLQALYSMSISLQNNLSVDFFDIWISEVYINKVPLKNKFIIKPYQKLESKEYITITLAYVIKKVSTKKKFVY*
Ga0115101_112587363300009592MarineMGKRKKRKTELTLRFPRNFQCATFNIKSENKLSPLAKFVLQGMQFKHFYYARDDIFYLLNSNPIEQDFLLQALYSISISLQNNLSVDFFDIWISEVHINKVPRKNKFIIKPYQKLESKEYITITLAYVIKKVSIKKKFVY*
Ga0115101_112679113300009592MarineKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0115101_120647223300009592MarineMARLELTLNFPKSFQVKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKR*
Ga0115101_149538263300009592MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKKIIVQY*
Ga0115011_10000519253300009593MarineMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVHNKFLNEKSQSLESDQYITIKLAYETSVS*
Ga0115011_1035092733300009593MarineFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNSIARDFLLLALYSILISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ*
Ga0115103_113299413300009599MarineLELTLNFPKSFQIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYVNKVSTHNKFMNRNSQNLEPGEYITIKLAYGSSVSQEKR*
Ga0115103_174575663300009599MarineMVRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKK*
Ga0115103_182834923300009599MarineLTLNFPKNFQIKTFNVKAEKKLSPLAKLILQSVQFKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQASQNLESSEYITIKLAYGKSGGFHEKK*
Ga0115102_1011117283300009606MarineMLDLKKKLSPLAKLILQSVQFKHFYYARDDIFYLLNSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMNHKLKSREYITIKLAYGSNRSQEKK*
Ga0115104_1051033533300009677MarineMVRLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQNLEPDEYITIKLAYGSTLSQEKK*
Ga0123361_104368213300009741MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMGQKSQNLES
Ga0123363_108892223300009747MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNL
Ga0123363_110444913300009747MarineKFNMARLELTLNFPKRFHIKTFNIKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMGQKSQNLESGEYITIKLAYGSSGSQEKK*
Ga0123366_105968123300009756MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0115012_1114237823300009790MarineMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMNQKSQNLEPNEY
Ga0123376_101294813300010129MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMGQKSQNLES
Ga0123382_111280733300010135MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIETNEYITIKL
Ga0102890_100311063300010309EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0102890_100367743300010309EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0136655_112140613300010316Freshwater To Marine Saline GradientMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQ
Ga0129333_1001217473300010354Freshwater To Marine Saline GradientMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSHPNKFINQKSQNLEPGEYITIKLAYGINVSQEK*
Ga0129333_1037736123300010354Freshwater To Marine Saline GradientMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESDQNKEFDEYITIKLAYGINTSQEKK*
Ga0129333_1045753713300010354Freshwater To Marine Saline GradientMARLELTLNFPKRFHIKTFNVKSEKMLSPLVKSIFQSAQFKHFYYVRDDIDYLLKSQPIERDFILQALYSIVLSLQNNFSINFFDMWVYEIYITKVLSSNKFLTKSYKDKEFEEYITIKLAYGINISQQKK*
Ga0129336_1013356233300010370Freshwater To Marine Saline GradientMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSHPNKFINQKSQNLEPGEYIT
Ga0129336_1036801333300010370Freshwater To Marine Saline GradientMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNLEADEYI
Ga0136852_1048013733300010412Mangrove SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMDEKYQNLEPGEYITIKLAYGVNTSQEKK*
Ga0133913_10009387153300010885Freshwater LakeMARLELTLNFPKNFDIKTINVKSKKKLSPLAKLILQNVRFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINYFDMWIYEIYINKVSTHNKFMSQKSQSPEPEEYITIKLAYGSSVL*
Ga0139329_10072833300010993SedimentMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0153799_102989013300012012FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLE
Ga0138265_1116537253300012408Polar MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSNVSQEKK*
Ga0138265_125972863300012408Polar MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAHNKFMSQKCQNLEPGEYITIKLAYGSSVSQEKK*
Ga0138265_131400723300012408Polar MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEVYINNVSTNNKFLNSKSQNLEPGEYITIKLAYGSNVSQEKK*
Ga0138265_141824263300012408Polar MarineMLKKQKKPRVELTFDFPKNFHVETFNIKSEKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIVISLQNNLSINFFDMWIYEIYINKVSTKNRFISQASKNLESIEYITIKLAYGSHGSQEKN*
Ga0138258_118774633300012413Polar MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWVYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK*
Ga0138258_134546913300012413Polar MarineFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAHNKFMSQKCQNLEPGEYITIKLAYGSSVSQEKK*
Ga0138263_170867023300012415Polar MarineEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0138259_151762963300012416Polar MarineMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDMWDYEVYVNKIPNFNKFMNQNQQNLEPCEYITIKLAYSVNLSNEKK*
Ga0138259_163792663300012416Polar MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAHNKFMSQKCQNLEPGEYITIKLAYGSSVSQEKKIIFHY*
Ga0138259_181485813300012416Polar MarineNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0138262_148572473300012417Polar MarineMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDIWVYEVYVNKIPNFNKFMNQNQQNLEPCEYITIKLAYSVNLSNEKK*
Ga0138261_100659513300012418Polar MarineNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0138261_117613263300012418Polar MarineLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPIERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRFNEKK*
Ga0138261_162362323300012418Polar MarineMLKKQKKPRVELTFDFPKNFHVETFNIKSEKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIVISLQNNLSINFFDMWIYEIYINKVSTKNRFISQASKNLESIEYITIKLAYGSHGSQEKKLIFHY*
Ga0138260_10224194173300012419Polar MarineLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0138260_1045611863300012419Polar MarineMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLVYGRNGGFQEKK*
Ga0129334_108891113300012471AqueousKKLNMARLELTLNFPKRFHIKTFNVKSELMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0129349_110910433300012518AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIET
Ga0138267_120704813300012767Polar MarineVNLFPHEHLNHILSQIKKQNVKKKVNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSNVSQEKK*
Ga0163111_1001822623300012954Surface SeawaterMPRLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQTVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSSVISLQNNFSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKPEEYITIKLAYGSSVS*
Ga0163111_1004204253300012954Surface SeawaterMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQNLEPDEYITIKLAYGSTLSQEKK*
Ga0163111_1118494513300012954Surface SeawaterLNFPKNFQVKTFNVKSEETLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSSVICLQNNLSIDFFDMWIYEIYINKVSNNNKFISQKSKILKPDEYITIKLAYGSNIPK*
Ga0163111_1127121623300012954Surface SeawaterMYVYFRKPRKKRRLELTLNFPKNFQIKTFNVKCEKKLSSLAKCILQSVQFKHFYYARDDIFYLLKSNTTERDFLLQALYSIVISVQNNLSINFFDMWIYEIYITTVPVNNRFLNEESQSLESDKYITIKLAYETSVS*
Ga0129335_111483813300012962AqueousMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0129338_135944433300012970AqueousMARLELTLNFPKRFHIKTFNVKSEPMLSSLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISTVSNSNKFLKESYQNKEFDEYITIKLAYGINTSQEKK*
Ga0171652_109105323300013110MarineNVKEKLSMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ*
Ga0171651_111075523300013115MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0177922_1068389713300013372FreshwaterKEKLNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0119889_100072713300013791WastewaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKVSNANKFLKESSQNKEFDEYITIKLAYGI
Ga0182080_169948443300016787Salt MarshMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIK
Ga0186561_10023463300017163Host-AssociatedMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNNNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK
Ga0181396_102925713300017729SeawaterMYKNIFSNEISKMNYELTLNFPKSFQVKTFNVKSDKKLSPLANLILNSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR
Ga0181407_104210733300017753SeawaterLFLHEHLNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0181590_1003459873300017967Salt MarshMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMDEKYQNLEPGEYITIKLAYGVNTSQEKK
Ga0181576_1066130713300017985Salt MarshMICSNRGELTLKFPKYFHIKTFSVKSEKIISPLAKSILQSVQFKHFYYVRDDIYYLLKSNSIERDFLLQALYSTVIALQNNLSINFFDMWIYEIYITKKPNSNKFLRETSQKKEFEEYITFKLAYNISEEKK
Ga0192960_10001783300018515MarineMLKKKRTKPRVELTLKFPKKFHVKTFNVRSEKKLSPLAKLILQSVQFKHFYYARDDIFYLLNSNPIERDFLLQALYSIVISLQNDLSINFFDMWIYEIYINKVSAKNKFMSHKLKSKEYITIKLAYGSNRSQEKK
Ga0192960_10001863300018515MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSINNKFMSHKSQSLEPGEYVTIKLAYGSSIS
Ga0192960_10002283300018515MarineLSLQEHLNHMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK
Ga0192960_10633013300018515MarineLAISLVNLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0192881_100019123300018603MarineMARLELTLNFPKSFQVKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDLSYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNRKHQNLEPGEYITIKLAYGSSVFQEKK
Ga0192881_102813813300018603MarineNFPESFHIKTFNLQPKKKLSPLANSILSSLKFKHFYYIRDDIAYLLKSNPVERDFLLQAFYSIILSLQNNLSVNFFDMWIYEIYITTVPANNKFLNEKPQSLELDEYITIKLAYETSVS
Ga0192881_102890413300018603MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIK
Ga0193415_101406623300018608MarineMPRLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQTVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSSVISLQNNFSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKPEEYITIKLAYGSSVS
Ga0193376_100002363300018635MarineMDKRKLELTLRFPENSKSLTFNIKSENKLSPLAKLILQGMQFKHFYYARDDIFYLLNSNPSEQEFLLQALYSISISLQNNLSVDFFDIWISDVYINKVPLKNKFIIEPYQKLESKEYITITLAYVTKKVSIEKKFVY
Ga0193376_100011413300018635MarineQYEQQKQYLELKANIEVYKTSPLRIDPPAKKRVELTLNFPKKFQIKTFHFKFEKKLSPLTKLILQSAQFKHFYYVRDDIFYLLKSNITERDCILQALYSIVIYLQNNLCIDFFDMWIYEVYINETLTKNKFTRQTSQNLESCEYITIKLAYGKK
Ga0193376_100085523300018635MarineMYVYFRKPRKKRRLELTLNFPKNFQIKTFNVKCEKKLSSLAKCILQSVQFKHFYYARDDIFYLLKSNTTERDFLLQALYSIVISVQNNLSINFFDMWIYEIYINEVSIKNKFMVQTSQNFESQEYITIKLAYGKKISK
Ga0188880_102212113300018640Freshwater LakeRLIKKQNVKEKSKMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0192969_100000773300018649MarineMLKKQKKPRVELTFDFPKNFHVETFNIKSEKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIVISLQNNLSINFFDMWIYEIYINKVSTKNRFISQASKNLESIEYITIKLAYGSHGSQEKN
Ga0192969_1000012163300018649MarineMKLQEIPKPRIELTLQFPKEIETEFKTFHIKSEKKLSSLAKSILQSARRKHFYYMRDDIDYGLKSTPIERDFLLQSLYSIVIFLQNNSSVNFFNIWVYEIYINKIPTSNKFINQRSQNLDPEEYITITLFYGDRYI
Ga0192952_100162133300018683MarineLFPHEHLNHILSQTKKQNVKKKVNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWVYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK
Ga0192983_100003393300018684MarineMLKKKRTKPRVELTLKFPKKFHVKTFNVRSEKKLSPLAKLILQSVQFKHFYYARDDIFYLLNSNPIERDFLLQALYSIVISLQNDLSINFFDMWIYEIYINKVSAKNKFMSHKLKSREYITIKLAYGSNRSQEKK
Ga0192944_100000163300018692MarineMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK
Ga0192954_100005163300018704MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWVYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK
Ga0192887_100265513300018713MarineMVIIKKKRRVELALKFPKKFQVKTFNIKSEKKLSSLAKSVLQGMQFKHFYYARDDIFYLLNSNSIEREFLLQTLYSISIYLQNNLSVNFFNIWIYEIYINKVPVKNKFITKAYQKLESREYITIKLAYV
Ga0192967_106845023300018730MarineMSNRIKNYNVKKTRKKRRLELTLNFPKSFQIKTFNVRSEKKLSSLAKLILQSVQFKHFYYARDDIFYLLKSNIAERDFILQALYSIVISLQNNLSINFFDMWIYEIYINEISTENKFMVQTSQNLESCEYITIKLAYGKKVA
Ga0193425_100064143300018743MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQSLEPEEYITIKLAYGSTLSQEKK
Ga0193000_102008713300018745MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQSLEPDEYITIKLAYGSTLSQEK
Ga0192950_100014363300018791MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWVYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEK
Ga0192950_105986513300018791MarineMGKRKKRKTELTLRFPKNFQRITFNIKSENKLSPLAKLILQGMQFKHFYYARDDIFYLLNSNPIEQEFLLQALYSIIISLQNNLSVDFFDIWISEVYINKVPLKNKFIIKPYQKLESKEYITITLAYVIKKVSTKKKFVY
Ga0193312_100003133300018844MarineMGYPKIELTLRFPANLKLLTFNIKSENKLSSLAKLILQGMQFKHFYYARDDIFYLLNSNPSEQEFLLQALYSISISLQNNLSVDFFDIWISDVYINKVPLKNKFIIEPYQTLESKEYITITLAYVRKKVSIEKKFVY
Ga0193284_104341613300018852MarineFPKNFQRVTFNIKSENKLSPLAKLILQGMQFKHFYYARDDIFYLLNSNPIEQEFLLQALYSMSISLQNNLSVDFFDIWISEVYINKVPLKNKFIIKPYQKLESKEYITITLAYVIKKVSTKKKFVY
Ga0193553_1000008243300018873MarineLFLHEHLNHILRQIKKQNVKEKLNMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQNLEPDEYITIKLAYGSTLSQEKK
Ga0192955_1000389033300018930MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQNLEPDEYITIKLAYGSTLSQEKK
Ga0192955_1007285433300018930MarineLSLQEHLNHMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQE
Ga0193426_1007426723300018942MarineFPKSFQIKTFNVKSEKTLSPLAKLILQTVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSSVIYLQNNLSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKPEEYITIKLAYGSSVS
Ga0193066_10000001203300018947MarineLSLHEHLNRILRRIKKQNVKEKPSMPRLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQTVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSSVISLQNNFSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKPEEYITIKLAYGSSVS
Ga0193066_1010663613300018947MarineLFLQEHLNHISRLIKKQNVKEKLNMVRLELTLNFPKSFEVKTFNVKCEGTLSPLTKLILQSVQFKHLYYVRDDISYLLKSNPIERDFLLQALYSSVICLQNNLSIDFFDMWVYEIYINKVSNNNKFISQKSKILKPDEYMTIKLAYGSNIPK
Ga0193562_1000623243300018965MarineLFLQEHLNHILRQIKKQNVKEKLSMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ
Ga0193293_1000008123300018966MarineMGKRKTELTLRFPKNFQRVTFNIKSENKLSPLAKLILQGMQFKHFYYARDDIFYLLNSNPIEQEFLLQALYSMSISLQNNLSVDFFDIWISEVYINKVPLKNKFIIKPYQKLESKEYITITLAYVIKKVSTKKKFVY
Ga0192873_1000853533300018974MarineMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ
Ga0193540_1000000563300018979MarineMGKPKTELTLRFPENLKSLTFNIKSENKLSSLAKLILQGMQFKHFYYARDDIFYLLNSNPSEQEFLLQALYSISISLQNNLSVDFFDIWISDVYINKVPLKNKFIIEPYQTLESKEYITITLAYVTKKVSIEKKFVY
Ga0192961_1000012023300018980MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0192961_1000012433300018980MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0192961_1000050163300018980MarineLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0192961_1000072233300018980MarineMGKRKKRKAELTLRFPENFQLATFNIKYENKLSPLAKFILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLSVDFFDIWIYEVYINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY
Ga0192961_1000116853300018980MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAYESSVSQEKNNSSILK
Ga0192961_1000175213300018980MarineMARLELTLNFPKSFQVKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSSHNKFMNRKHQNLEPGEYITIKLAYGSSVSQEKK
Ga0192961_1000643743300018980MarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR
Ga0192961_1000672523300018980MarineMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSLKFKHFYYIRDDIAYLLKSNPVERDFLLQAFYSIILSLQNNLSVNFFDMWIYEIYITTVPANNKFLNEKPQSLELDEYITIKLAYETSVS
Ga0192961_1000745033300018980MarineLSLHEHLNHILSQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0192961_1001733843300018980MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK
Ga0192961_1009457023300018980MarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRFNEKK
Ga0192968_10000223123300018981MarineLKLLILNLKKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIVISLQNNLSINFFDMWIYEIYINKVSTKNRFISQASKNLESIEYITIKLAYGSHGSQEKN
Ga0192953_1000004733300019000MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWVYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGE
Ga0193034_1001437623300019001MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0192880_1000067563300019009MarineMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK
Ga0192880_1000259123300019009MarineMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0193044_1000042383300019010MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWIYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK
Ga0193044_1000091043300019010MarineLFPHEHLNHILSQIKKQNVKKKVNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNSSINFFDMWIYEIYINKVPTHNKFMSQKSQNLEPGEYLTIKLAYGSSISQEKK
Ga0193044_1000094983300019010MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAHNKFMSQKCQNLEPGEYITIKLAYGSSVSQEKK
Ga0192951_1000023633300019022MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTFPTNNKFMNHKSQNLEPDEYITIKLAYGSTLSQEKK
Ga0192886_1000020533300019037MarineMVIIKKKRRVELALKFPKKFQVKTFNIKSEKKLSSLAKSVLQGMQFKHFYYARDDIFYLLNSNSIEREFLLQTLYSISIYLQNNLSVNFFNIWIYEIYINKVPVKNKFITKAYQKLESREYITIKLAYVIKKVLKKEKFVY
Ga0193082_1000003793300019049MarineMAGLELTLNFPESFHIKTFNLKPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVNNKFLNEKSQSLESDKYITIKLAYETSVF
Ga0193082_1008089233300019049MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKVILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193102_102584813300019099MarineNLFQQEHLNHILKLIKKQNVKEKIMAGLELTLNFPESFHIKTFNLKPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVNNKFLNEKSQSLESDKYITIKLAYETSVF
Ga0193045_102119623300019100MarineLFPHEHLNHILSQIKKQNVKKKVNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAHNKFMSQKCQNLEPGEYITIKLAYGSSVSQEKK
Ga0193104_100098513300019125MarineNVKSEKKLSPLTKLILQSVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSSVIYLQNNLSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKLEEYITIKLAYGSSVSS
Ga0193089_100625833300019133MarineMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLESDEYITIKLAYGSSVPQEKK
Ga0193089_106917523300019133MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0180035_104669623300019191EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0180035_109735713300019191EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAY
Ga0180033_17563783300019198EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKKIIFQ
Ga0180036_100507663300019200EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0180036_102673213300019200EstuarineLFLQEHLNHILSQIKKQNVKEKLNMVRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKK
Ga0180036_103005913300019200EstuarineMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIYMTKISTPNKFLKKNSQNKEFDEYITIKLAYNII
Ga0180036_1038618123300019200EstuarineMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFLLQTLFSIAISLQNNLSIDFFDMWIYEIYLTKVSNPNKFIKEVYQHKEFNEYITIKLAYKIDSPKEKKKTYK
Ga0180036_107343253300019200EstuarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0180032_100499733300019201EstuarineLFLQEHLDHILRPIKKQNVKEKRNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0180032_100698533300019201EstuarineLFLLEHLNHILRLIKKQNVKEKSKMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0180032_105756523300019201EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK
Ga0180032_107040823300019201EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0180032_110763523300019201EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0180032_113931263300019201EstuarineMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICLQNNLSVNFFDMWIYEIYITKISTPNKFLKKSSQNKEFDEYITIKLAYNIL
Ga0180034_103186313300019207EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKL
Ga0180034_103259723300019207EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEP
Ga0180034_110301413300019207EstuarineLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0180037_103366133300019214EstuarineMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0180037_114640633300019214EstuarineMGKRKKRKTELTLRFPRNFQCATFNIKSENKLSPLAKFVLQGMQFKHFYYARDDIFYLLNSNPIEQDFLLQALYSISISLQNNLSVDFFDIWISEVHINKVPRKNKFIIKPYQKLESKEYITITLAYVIKKVSIKKKFVY
Ga0180037_1193233133300019214EstuarineLFLQEHLNHILSQIKKQNVKEKLNMVRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKK
Ga0180037_121607813300019214EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0182064_125820863300019253Salt MarshMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQGVQFKHFYYVRDDISYLLKSKPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQNFQNLEPAEYITIKLAYGINVSQEKNNILVV
Ga0182064_126721253300019253Salt MarshMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINNVPTNNKFMSQKSQNLEPGEYITIKLAYGSTPSQEKK
Ga0194017_100514733300019696SedimentLFLQEHLNHTLRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGNNVSQEKK
Ga0193985_102000123300019699SedimentFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0194006_100852423300019700SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIEISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNIEPDEYITIKLAYGSNVSQEKK
Ga0194015_103386323300019701SedimentRLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193997_100340333300019702SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194021_1000013103300019703SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194021_1000028103300019703SedimentLFLQEHLNHTLRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0194021_100277323300019703SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFINDKSQNLEQGEYITIKLAYGSSASQEKK
Ga0193979_101075813300019704SedimentLFLHEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193979_103190013300019704SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193981_100059353300019705SedimentLFLHEHLNRILRPIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193995_100801633300019706SedimentRLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193995_100884433300019706SedimentFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0194016_100762013300019708SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEY
Ga0193967_102528013300019709SedimentHEHLNRILRPIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194009_101303123300019710SedimentMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0193993_101021823300019711SedimentMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193969_101205023300019712SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193975_103114013300019714SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193966_100629823300019715SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYRSSVSQEKK
Ga0193984_104345613300019716SedimentLHEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193972_100295033300019717SedimentNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193999_100099833300019718SedimentLFLHEHSNHTLRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193977_100431833300019719SedimentHTLRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193977_101357713300019719SedimentLFLHEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194011_100010273300019721SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINNVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194011_100295313300019721SedimentQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFINDKSQNLEQGEYITIKLAYGSSASQEKK
Ga0193980_100128913300019725SedimentSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193980_102287413300019725SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQK
Ga0193974_100082553300019726SedimentSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193974_100517913300019726SedimentMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIYMTKISTPNKFLKKNSQNKEFDEYITIKLAYNIFQEKK
Ga0193974_101561813300019726SedimentKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193976_100903233300019727SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKL
Ga0193968_100193433300019729SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194001_101279733300019730SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0194013_100025023300019733SedimentLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194013_103404913300019733SedimentMARLELTLNFPKRFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIYMTKISTPNKFLKKNSQNKEFDEYITIKLAYNI
Ga0193970_100243033300019734SedimentLFLHEHLNRILRPIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193990_103015123300019735SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNLESDEYITIKLAYGS
Ga0193973_105392213300019737SedimentIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0193973_106622023300019737SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK
Ga0193994_100766733300019738SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSSVSQEKK
Ga0194012_102848823300019739SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNLESDEYITIKLAYGSSVSQE
Ga0193988_100217233300019740SedimentLFLHEHLNRILRPIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0194020_100021763300019741SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193992_102631223300019743SedimentMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSSVSQEKK
Ga0193992_104400823300019743SedimentLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193998_100694933300019744SedimentLFLHEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194008_100397433300019746SedimentHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194008_102465733300019746SedimentLFLQEHLNHTLRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYIT
Ga0193983_100096143300019749SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS
Ga0194000_102976723300019750SedimentMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS
Ga0194000_104877723300019750SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNL
Ga0194000_106532213300019750SedimentSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVLSLQNNLSVNFFDIWIYEIYINRISTHNKFLDQKSQNLEPDEYITIKLAYGSSLSQEKK
Ga0193958_106921423300019752Freshwater Microbial MatMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGE
Ga0194010_106956113300019753SedimentHLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVLSLQNNLSVNFFDIWIYEIYINRISTHNKFLDQKSQNLEPDEYITIKLAYGSSLSQEKK
Ga0193954_110796923300019755Freshwater Microbial MatMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193961_105336523300019759Freshwater Microbial MatLFLQEHLNHILRQIKKQNVKEKINMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193960_107719813300019768Freshwater Microbial MatMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194005_10273233300019934SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQH
Ga0194022_1000014153300019937FreshwaterMARLELTLNFPKRFHIKTFNVKSEKMLSPLVKSIFQSAQFKHFYYVRDDIDYLLKSQPIERDFILQALYSIVLSLQNNFSINFFDMWVYEIYITKVLSSNKFLTKSYKDKEFEEYITIKLAYGINISQQKK
Ga0194022_101306723300019937FreshwaterMARLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0207193_1003372153300020048Freshwater Lake SedimentLFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0207193_102772663300020048Freshwater Lake SedimentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKMSNPNKFLKESSQNKEFDEYITIKLAYGVNTSQEKK
Ga0194113_10007146153300020074Freshwater LakeLFLREHLNHILKLTKKQNDKEKVPMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGEYITIKLAYGSSVSQEKK
Ga0211734_1054004223300020159FreshwaterLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0211734_10939910133300020159FreshwaterLFLRELLNHILKPIKKQNVKEKLIMARLELTLNFPKSFHLKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0211733_1069923533300020160FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0211733_1110548323300020160FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0211726_1017149233300020161FreshwaterLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0211729_1090522133300020172FreshwaterLFLRERLNHILKPIKKQNVKEKLIMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0181596_10001204153300020177Salt MarshMARLELTLNFPKRFHIKTFNVKSEKMLSPLVKSIFQSAQFKHFYYVRDDIDYLLKSQPIERDFILQALYSIVLSLQNNFSINFFDMWVYEIYITKVLSSNKFLTKSYKDKEFEEYITIKLAYGINISQQKNNIL
Ga0181596_1024498523300020177Salt MarshMARLELTLNFPKSFQIKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDLSYLLKSNPMERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNRKCQNLEPGEYITIKLAYGSSVSQEKK
Ga0194124_1031373023300020196Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGEYITIKLAYGSSVSQEKK
Ga0211731_1116325133300020205FreshwaterLFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194127_1022389933300020221Freshwater LakeLFLREHLNHILKLTKKQNDKEKVPMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSFPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGG
Ga0211505_112115323300020352MarineNFQIKTFHFKSEKKLSSLTKLILQSIQFKHFYYVRDDIFYLLKSNMAERDCILQGLYSIVIYLQNNLSINFFDMWIYEVYINESLTKNKFMSQTSQNIKSYEYITIKLAYKKS
Ga0208591_100657833300020493FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0208230_1000023313300020496FreshwaterLFLHEHLNHILKLIKKRNVKEKLTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0207934_1000053313300020561FreshwaterLFLHEHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0207934_104311613300020561FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSENIEPGEYITIKLAYGSSVSQEKK
Ga0206679_1041500923300021089SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194123_10018612133300021093Freshwater LakeFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGEYITIKLAYGSSVSQEKK
Ga0210340_101954333300021273EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0210303_105770023300021282EstuarineLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKIFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK
Ga0210299_15024813300021284EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGE
Ga0210299_15135513300021284EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGS
Ga0210300_12538123300021296EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0210308_103567523300021303EstuarineLFLHEHLNHILKQTKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210296_107113543300021305EstuarineMARLELTLNFPKSFQIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNRNSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210370_106131343300021314EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK
Ga0210295_104424033300021323EstuarineLFLLEHLNHILRLIKKQNVKEKSKMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210298_103841423300021328EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0213867_1000181153300021335SeawaterLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0210307_112570723300021336EstuarineLFLHEHLNHILRQIKKQNVKENLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210307_134470823300021336EstuarineVSLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0213862_1023716123300021347SeawaterIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSPKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0206693_121152413300021353SeawaterLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNRKHQNL
Ga0213858_1001093353300021356SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNDKSQNLEADEYITIKIAYGFNVSQERK
Ga0213859_1001411763300021364SeawaterMACSNRGELTLKFPECFHIKTFNIQSEKILSPLAKSILQSLQFKHFYYVRDDIHYLLKSYPTERDFLLQALYSIVISLQNNFSINFFDMWIYEIYITKVSKPNKFLKQTYQYKGFDEYITIKLAYNISPEKK
Ga0213859_1002473833300021364SeawaterMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLLQALYSIVISLQNNFSINFFDMWVYEIYITKISNSNKFLRKTYQNKEFDEYITIKLAYNISHDKK
Ga0213860_10000151173300021368SeawaterMARLELTLNFPKRFHIKTFNVKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLAVNFFDMWIYEIYITKVSNVNKFLRKSDQKKEFDEYITIKLAYGINISQEKK
Ga0213860_10001382173300021368SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0213860_1000154553300021368SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSRHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0213863_10000621313300021371SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQERK
Ga0213863_1000569213300021371SeawaterLIKKQNVKEKLNMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0213863_1008051913300021371SeawaterMARLELTLNFPKRFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAYESSVSQEKNNSSILK
Ga0213863_1012118123300021371SeawaterMIKKQNVKEKSKMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0213863_1031298613300021371SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0213865_10000488153300021373SeawaterLFLHEHSNHTLRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0213861_10001223283300021378SeawaterLFLQEHLNHTLRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0213864_10001327153300021379SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNFSINFFDMWVYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0213864_1002536643300021379SeawaterMICKKRRELALKFPKCFHIKTFNIKSEHNISPLAKSILQSLQFKHFYYALDDISYLLNPCPIERDFFLQIFSSVAIFVQNNLSINFFDMWIHEIYITEVSTPNKFLRENSNNKEFYEYITIKLAYSMTQEKK
Ga0213864_1016967923300021379SeawaterMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSPKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0213864_1057793813300021379SeawaterKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVCDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNDKSQNLEADEYITIKIAYGFNVSQERK
Ga0213866_1000371033300021425SeawaterMARLELTLNLPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIKTDEYITIKLAYGFNVSQEKK
Ga0193947_100422323300021465SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNIEPDEYITIKLAYGSSVSQEKK
Ga0193945_103156013300021497SedimentFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNIEPDEYITIKLAYGSSVSQEKK
Ga0193948_103700523300021501SedimentLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0210305_114134413300021847EstuarineLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRK
Ga0210304_110284423300021849EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0222717_10000776153300021957Estuarine WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK
Ga0222717_10001926193300021957Estuarine WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0222717_1000591493300021957Estuarine WaterLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0222717_1002624523300021957Estuarine WaterMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0222717_1007628933300021957Estuarine WaterLFLQEHLNHILRLIKKQNVKEKLNMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK
Ga0222718_1012216523300021958Estuarine WaterLFLQEHLNHTLKPIKKQNVKEKLNMARVELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0222718_1020650523300021958Estuarine WaterLFLHEHLNHILRQIKKQNVKEKQNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0222718_1032091023300021958Estuarine WaterMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK
Ga0222716_1003092593300021959Estuarine WaterVNLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0222715_1001412933300021960Estuarine WaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSERSQNLEPGEYITIKLAYGSSVS
Ga0222714_1042472813300021961Estuarine WaterMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICLQNNLSVNFFDMWIYEIYITKISTPNKFLKKSSQNKEFDEYITIKLAY
Ga0222713_1036235123300021962Estuarine WaterMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0224498_1003685733300022202SedimentLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK
Ga0224499_1028579023300022206SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKS
Ga0224514_1001085333300022217SedimentLFLHEHLNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK
Ga0224501_1027474023300022223SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNIEPDEYITIKLAYGSSVSQEKK
Ga0224501_1047586423300022223SedimentLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILKSVQYKHFYYVRDDISYLLKSNPIEQEFILDALDSMAISLQNNLSINFFDMWIYEIYINKISNNNKFINKKSQNLESGEYLTIKLAYSMNIFQEKK
Ga0224510_10000620153300022309SedimentMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSHPNKFINQKSQNLEPGEYITIKLAYGINVSQEK
Ga0210312_10144313300022367EstuarineMARLELTLNFPKRFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAY
Ga0210312_11697523300022367EstuarineIKKQNVKEKLNMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK
Ga0210310_103574513300022369EstuarineVNLSLHEHLNHILSQIKKQNVKENLNMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0210293_10177913300022372EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQ
Ga0210293_10926813300022372EstuarineNVKEKLNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0210311_101721023300022374EstuarineMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFLLQTLFSIAISLQNNLSIDFFDMWIYEIYLTKVSKPNKFIKEVYQHKEFNEYITIKLAYKIDSPKEKKKTYK
Ga0210311_102915313300022374EstuarineFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQALYSIVISLQNNLCINFFDMWVYEVYINKVPNFNKFINQNLQQLEPEEYVTIKLAYSVNRFNEKNNIS
Ga0210313_101085723300022375EstuarineMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFLLQTLFSIAISLQNNLSIDFFDMFIYEIYLTKVANPNKFIKEVYQHKEFNEYITIKLAYKIDSPKEKKKTYK
Ga0210313_102788713300022375EstuarineELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
(restricted) Ga0233404_10000040313300022913SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK
(restricted) Ga0233411_1010558533300023112SeawaterLFLQEHLNHTLKPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLA
(restricted) Ga0233405_10000008153300023114SeawaterLFLQEHLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
(restricted) Ga0233405_1003127623300023114SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYILKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVS
(restricted) Ga0233410_1016741923300023276SeawaterKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
(restricted) Ga0255039_10000702153300024062SeawaterLFRQEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNISQEKK
(restricted) Ga0255039_1003735013300024062SeawaterARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0244777_10000315153300024343EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK
Ga0244777_10001676103300024343EstuarineLFLHEHLNLILSRIKKQNVKEKLSMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS
Ga0244777_1000208173300024343EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
Ga0244777_1043821623300024343EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSQNSQNLEPGEYLTIKLAYGNSIS
Ga0244775_1011000543300024346EstuarineMARLELTLNFPKRFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLKSHPMERDFLLQVLFSIAIYLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK
Ga0244775_1011351733300024346EstuarineLFLHEHLNHILSLIKKQNVKEKLSMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLEPDEYITIKLAYGSSVS
Ga0244775_1029576313300024346EstuarineMARLELTLNFPKRFHIKTFNVKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLAVNFFDMWIYEIYITKVSNVNKFLRKSNQKKEFDE
Ga0244775_1058003933300024346EstuarineLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQ
Ga0244775_1088631023300024346EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAY
Ga0244776_1057912223300024348EstuarineRLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0256357_104594023300024534FreshwaterMARLELTLNFPKRFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISTVSNSNKFLKESYQNKEFDEYITIKLAYGINTSQEKK
Ga0255294_105756113300024544FreshwaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKVSNANKFLKESSQNKEFDEYI
Ga0255295_107487323300024852FreshwaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKVSNANKFLKESSQNKEFDEYITIKLAYA
Ga0209652_100873843300025684MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILKSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSTNNKFMTQKSPNLEPGEYITIKLAYGSTLSQEKKIF
Ga0209652_104774233300025684MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK
Ga0208784_108376723300025732AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPVEYITIKLAYGSSVSQEKK
Ga0208784_121933913300025732AqueousVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0209600_102246723300025821Pelagic MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK
Ga0208917_100239383300025840AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMGQKSQNLESGEYITIKLAYGSSGSQEKK
Ga0208917_103468943300025840AqueousLFLHEHLNLILRQIKKQNVKEKLTMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208917_116403823300025840AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSS
Ga0208005_1000087313300025848AqueousMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYFLKSNPTEKDFLLEALYSIVISLQNNLSINFFDIWVYEIYINKVSHYNKFIKEKYHNLEPDEYLTIKVAYGIPIFQEKK
Ga0208005_102969523300025848AqueousMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYITKVSNSNKFLRETYQNKEFDEYITIKLAYGINISQEKK
Ga0209456_1000946393300025883Pelagic MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAYESSVSQEKNNSSILK
Ga0209335_1032046623300025894Pelagic MarineEHLNHILRQIKKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQAFYSIILSLQNNLSVNFFDMWIYEIYITTVPANNKFLNEKPQSLELDEYITIKLAYETSVS
Ga0209927_102013433300026106SoilMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLE
Ga0209955_101208353300026123WaterMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYI
Ga0209955_101513133300026123WaterMARLELTLNFPKSFYVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSTNFFDIWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209962_100600123300026125WaterMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209957_101204613300026126SoilNLFLHEHLNHILRQIKKQNVKEKQNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0209940_101219813300026133SoilLRQIKKQNVKEKQNMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0256355_102342033300026563FreshwaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYINKVSHPNKFINQKSQNLEPGEYITIKLAYGINVSQEK
Ga0209850_100018313300026931SandMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0255198_104446513300027160FreshwaterHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDMWIYEIYISKVSNANKFLKESSQNKEFDEYITIKLAYGINTSQEKK
Ga0208438_106656023300027196EstuarineKSFYIKTFNVKSEKKLSPLAKLMLQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208925_100033183300027203EstuarineNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208925_10013953300027203EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLMLQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208924_11403023300027204EstuarineLTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208554_107835113300027212EstuarineEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208166_100160433300027215EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208677_101746613300027216EstuarineIKKQNVKEKLSMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS
Ga0208165_101443213300027218EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208169_101076643300027223EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKL
Ga0208025_100085283300027225EstuarineLFLHEHLDHILRLIKKQNVKEKRNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208308_102101113300027228EstuarineRLIKKQNVKEKRNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK
Ga0208171_1000072123300027230EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS
Ga0208171_100012633300027230EstuarineLFLHEHLDHILRLIKKQNVKEKRNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK
Ga0208171_102747113300027230EstuarineLFLQEHLNHILRQIKKQNVKEKINMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208804_100148533300027235EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK
Ga0208804_100473633300027235EstuarineLFLHEHLNHILRQIKKQNVKENLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208808_104354513300027238EstuarineLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208444_102801723300027240EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNV
Ga0208445_102420723300027245EstuarineKRKAELTLRFPENFQLATFNIKYENKLSPLAKFILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLSVDFFDIWIYEVYINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY
Ga0208931_102970033300027246EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208176_100158293300027248EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208809_105448123300027251EstuarineLTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208680_108172013300027253EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0208796_103819013300027308EstuarinePKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQER
Ga0208796_105541223300027308EstuarineMARLELTLNFPKRFHIKTFNVKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLAVNFFDMWIYEIYITKVSNVNKFLRKSNQKKEFDEYITIKLAYGINISQEKK
Ga0207994_100066513300027416EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYG
Ga0207994_101125643300027416EstuarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYI
Ga0208948_104080833300027501MarineLRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0208973_108093913300027506MarineRLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0208964_112285213300027572MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSS
Ga0209278_1000358313300027673Wastewater EffluentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKKSSQNKELDEYITIKLAYGINTSQEKKIIF
Ga0209392_109757233300027683Freshwater SedimentELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSENIEPGEYITIKLAYGSSVSQEKK
Ga0209815_100771153300027714MarineMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDMWVYEVYVNKIPNFNKFMNQNQQNLEPCEYITIKLAYSVNLSNEKK
Ga0209815_125325113300027714MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPIERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIK
(restricted) Ga0247833_1014505143300027730FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYISKVSPHNKFMSQKSENLEPGEYITIKLAYGSSVFQEKK
Ga0208304_1001178233300027751EstuarineLFLHEHLNHILKLIKKRNVKEKLTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0208305_1000427973300027753EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK
Ga0208305_1001053613300027753EstuarineFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0208305_1009903513300027753EstuarineFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR
Ga0208671_1002270843300027757EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0208671_1003499813300027757EstuarineLNHILRQIKKQNVKEKLNMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK
Ga0208671_1004769133300027757EstuarineMACTSRGELTLKFPKNFHIKTFNVKSEKILSPLAKSILQSVQFKHFYYVRDDLYYLLKSEPIERDFLLQALYSIVLSLQNNLSINFFDMWVYEIYITKISNPNKFLRQIYQNKEFDEYITIKLAYNISQEKK
Ga0208671_1036126813300027757EstuarineHLNHILKLIKKRNVKEKLNMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0209277_10000299153300027776Wastewater EffluentMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK
Ga0209175_1024984113300027781Wastewater EffluentKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGVNTSQEKK
Ga0209812_10000756313300027786Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKANPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFIDKKNQNLEPGEYITIKLAYGVNTSQEKK
Ga0209174_1013105623300027789Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLEALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFMYEKYQNLEPGEYITIKLAYGVNTSQEKK
Ga0209302_10000886153300027810MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPIERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRFNEKK
Ga0209302_1001626633300027810MarineLFLHEHLNHILRQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209092_1005739213300027833MarineVKLTAINDADRSTDPPKKRRVELTLNFPKNFQIKTFHFKYEKKLSSLTKLILQSIQFKHFYYVRDDIFYLLKSNIAERDYILQALYSIVIYLQNNLSINFFDMWIYEVYINETLTKNKFLIQTSQNIESCEYITIKLAYGKKLT
(restricted) Ga0255041_1014749223300027837SeawaterPIKKQNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0209712_1000093583300027849MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209712_1015022833300027849MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTENKFMSSKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209713_1003785163300027883MarineMAGLELTLNFPESFHIKTFNLKPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVNNRFLNEKSQSLESDKYITIKLAYETSVS
Ga0209450_10000295153300027885Freshwater Lake SedimentLFLHEHLNHILKLIKKRNVKEKLTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQKVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0209496_1035761623300027890WetlandMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAY
Ga0209668_1000148643300027899Freshwater Lake SedimentLFRHEHLDHILRPIKKQNVKEKRNMARLELTLNFPKTFHIKTFNVKSEKKLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYESSVFQEKK
Ga0209668_1000202283300027899Freshwater Lake SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYISKVSSHNKFMNQKSENLETGEYITIKLAYGNSVFQEKK
Ga0209404_10002333163300027906MarineLFRQEHLNHILKLIKKQNVKEKRMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSIKFKHFYYVRDDIAYLLNSNPLERDFLLQAFYSIILSLQNNSSVNFFDMWIYEIYITTVPVHNKFLNEKSQSLESDQYITIKLAYETSVS
(restricted) Ga0247834_121119613300027977FreshwaterIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYISKVSPHNKFMSQKSENLEPGEYITIKLAYGSSVFQEKK
Ga0255234_117645013300028113FreshwaterMLNLKKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
Ga0256358_105159413300028267FreshwaterLFLHEHLNHTLKLIKKQNVKAKKLNMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPTEREFLLQALFSTVISLQNNLSIDFFDMWIYEIYISKVLNPNKFLKENAK
Ga0210315_101660923300028329EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK
Ga0210314_10984023300028524EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
Ga0272412_113306513300028647Activated SludgeMARLELTLNFPKRFHIKTFNVKSELMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISKVSNSNKFLKESYQNKEFDEYITIKLAYGINPFQEKK
Ga0307996_1000066303300031589MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEVYINNVSTNNKFLNSKSQNLEPGEYITIKLAYGSNVSQEKK
Ga0307996_100083833300031589MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKYENIEPGEYITIKLAYGSSVSQEKN
Ga0307984_1000734173300031658MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYDIYINKVTTHNRFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0315907_1008729663300031758FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0315907_1099679923300031758FreshwaterRLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0315899_1020009123300031784FreshwaterLFLHEHLDHILKLIKKQNVKEKRNMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK
Ga0315908_1042468113300031786FreshwaterIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK
Ga0315320_1010258033300031851SeawaterLFQQEHLNHTLRQIRKLNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0315901_1049162713300031963FreshwaterRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0315315_1057397023300032073SeawaterMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSISFFDIWIYEIYINKVSTHNKFMRKKSQNLEPDEYITIKLAYGSSVS
Ga0315905_1024654413300032092FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0315905_1137078323300032092FreshwaterLFLPEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0316201_1121759423300032136Worm BurrowMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKS
Ga0314779_100251513300032150SedimentMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEP
Ga0316191_1065788723300032258Worm BurrowMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0316192_1042511413300032260Worm BurrowMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFN
Ga0316195_1001776693300032263SedimentMARLELTLNFPERFQIKTFNVKSEQIFSPLAQSILQSVQFKHFYYVRDDIDYCLKSYPREREFLLQTLFSIAISLQNNLSIDFFDMWIYEIYLTKVSNPNKFINEVYQNKEFNEYLTIKLAYKIDSPKEKKKNYK
Ga0316189_10000912143300032272Worm BurrowMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLEPDEYITIKLAYGSSVS
Ga0316188_1001655033300032276Worm BurrowMARLELTLNFPERFQIKTFNVKSEQIFSPLAKSILQSVQFKHFYYVRDDIDYCLKSYPREREFLLQTLFSIAISLQNNLSIDFFDMWIYEIYLTKVSNPNKFINEVYQNKEFNEYLTIKLAYKIDSPKEKKKNYK
Ga0316202_1012012233300032277Microbial MatLFLHEHLNHILKQIKKQNVKEKLNMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS
Ga0316204_1073146813300032373Microbial MatMARLELTLNFPKSFQIKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDLSYLLKSNPMERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSSKSQNLEPGEYITIKLAYGSSVS
Ga0316625_10006897133300033418SoilMARLELTLNFPKHFHIKTFNVKSEPMLSSLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISKVSKPNKFLKESNQNKEYDEYITIKLAYGINTSQEKK
Ga0316625_10154737623300033418SoilVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0316625_10178347013300033418SoilMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFISQKSENLEPGEYITIKLAYGSSISQEKK
Ga0316629_1141987813300033483SoilMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSENLEPG
Ga0316616_10285695623300033521SoilMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTDNKFMSQKSENLESGEYITIKLAYGSSISQEKK
Ga0334977_0032598_78_4733300033978FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0334989_0000257_9312_97073300033984FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0334998_0067034_3_3653300034019FreshwaterKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0334998_0129628_1076_14713300034019FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSENLEPGEYITIKLAYGSSVSQEKK
Ga0334998_0218228_203_5983300034019FreshwaterMARLELTLNFPKTFHIKTFNVKSEKKLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSVFQEKK
Ga0335004_0121250_227_6223300034021FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0334983_0201073_892_12363300034060FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEY
Ga0335019_0132840_3_3803300034066FreshwaterMFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKF
Ga0335019_0668040_242_5983300034066FreshwaterFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0310127_189305_3_3683300034072Fracking WaterMARLELTLNFPKRFHIKTFNVKSEPMLSPIAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISTVSNSNKFLKESYQNKEFDEYITIKLAY
Ga0335037_0000364_20858_212533300034107FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0335037_0290123_359_8323300034107FreshwaterVSLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYGSSVSQEKK
Ga0335063_0259319_171_5663300034111FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPNERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK
Ga0335065_0611265_73_5463300034200FreshwaterVSLFLPEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0335039_0559213_2_4483300034355FreshwaterVSLFLQEHLNHILKPTKKQNDKEKVTMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKFILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKCQNIEPGEYITIKLAYG
Ga0335064_0028777_339_7343300034357FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.