NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017163

3300017163: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 661 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1410)



Overview

Basic Information
IMG/M Taxon OID3300017163 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212273 | Ga0186561
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 661 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1410)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size32909016
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)37.0Long. (o)-65.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186561_100234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5883Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186561_100234Ga0186561_1002346F001488MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNNNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.