NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003691

3300003691: Combined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico



Overview

Basic Information
IMG/M Taxon OID3300003691 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0113788 | Gp0109249 | Ga0062319
Sample NameCombined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico
Sequencing StatusFinished
Sequencing CenterArgonne National Laboratory
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size180801331
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2
All Organisms → Viruses → Predicted Viral2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameOil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment → Oil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biome → marine benthic feature → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationGulf of Mexico, USA
CoordinatesLat. (o)28.74511Long. (o)-88.35914Alt. (m)N/ADepth (m)0 to .01
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y
F001506Metagenome / Metatranscriptome681Y
F009686Metagenome / Metatranscriptome314Y
F025922Metagenome / Metatranscriptome199Y
F071271Metagenome / Metatranscriptome122Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JT63_1002746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9392Open in IMG/M
JT63_1016469All Organisms → Viruses → Predicted Viral3527Open in IMG/M
JT63_1027053All Organisms → Viruses → Predicted Viral2625Open in IMG/M
JT63_1033725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2296Open in IMG/M
JT63_1038282Not Available2127Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JT63_1002746JT63_10027463F001488MARLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
JT63_1010156JT63_10101562F071271MSFSSKFTGKNPINKQDPPNQSNAFSNIEHKGEEFLNFPQEKARQRTDEYLNITPDKDGLMKEQNSFEHGDTARHYFAGDQTSRSIQNKLGSFGKTLPGKTIGVIGSNLGGLIHEAQNIKDGRPILESVEDATNNFVGSLGSLFSTNTSTKILDRLKKYLPDGKVVK*
JT63_1016469JT63_101646912F009686MFEKSFQRPTNYFNLEEERQWAIDKSLGILDWQGDNLNTEDLLRYAEHYE*
JT63_1027053JT63_10270534F025922MARNRIIYASQSVWCNGDLLYRVQSLGSTTTFTSEDIFELGHLDIIDVVDDVPSVAVTLNTNDFGDVTTFATLAQVLPARRAMDATASISNSNLEVVDASLTGIGTYLHGVCVPDFAIACGALPGVSIWAPVQEECSLGSLADNI
JT63_1033725JT63_10337254F001506MNQTLYKTKCQCNSEILLTKKHKLRKRGEGKLLQYPNPDEIISKTFKIKYKKKLSSISKLVLNSFQNKHIYYALDDILYLFKSNLSEQRDLLGIISSPVLFLQNNFSINFFDLWIHEIYITEIPKVNKFLINDAPKIEQHYITIKFLYKKIVPIKKSDLLW*
JT63_1038282JT63_10382823F009686MSTEKEMFEKSFKRPTNYFALTSKEQWEIDRKLGILDWEGTGLTNKDIKRFEKHYE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.