Protein Family IF14086
Metagenome
Isolate
308
Members
211
Samples
137
Scaffolds
552.82
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8102014801|8102015641|
- Length
- 597 aa
- Sequence
- MVRLSPGYQTAGDARRVSAPLSDTAVQIKYWQAWRLGFVSTSTVEQDDVALVRDSMEYDVVIVGGGPAGLSAAIRLKQLAEEKGADISVCLLEKGSEIGAHILSGAVMDPRALTELIPDWKEQGAPLNVPVTEDRFLFLSETGAKAVPNWMLPHNFKNHGNYVISLANVTRWLGTVAEAMGVEIFPGFPAAEILFNDDGSVKGVATGNMGIGKDGQPTENFQLGMELHAKYTLFCEGCRGHLGRQLNERLHLSKDSDPQVYGIGIKELWEIDPAKHQPGLVIHTAGWPLESDTYGGSYLYHTDNNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYGARAITAGGLMSLPKLVFPGGALVGDNAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQGNRKHDELTDYPEAFRKSWLHDELHRARNFKQWMSKGLYLGTLMVGIEQKLFGGSVPWTLHHRHRDHEMLKPASQCKPIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDAAVPVNVNLRAYAGPESRFCPAGVYEFVKDDSDEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM
Sample Types
Isolate
55.5%
Metagenome
44.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
38.5%
Unclassified
11.5%
Elmidae
9.1%
Formicidae
6.7%
Termitidae
6.7%
Kalotermitidae
5.3%
Drosophilidae
3.4%
Culicidae
3.4%
Armadillidiidae
2.9%
Curculionidae
1.9%
Rhinotermitidae
1.4%
Largidae
1.0%
Apidae
1.0%
Hydrophilidae
1.0%
Psyllidae
1.0%
Berytidae
1.0%
Termopsidae
1.0%
Alydidae
1.0%
Tenebrionidae
0.5%
Calliphoridae
0.5%
Passalidae
0.5%
Pteromalidae
0.5%
Crambidae
0.5%
Taxonomy
Archaea
0
Bacteria
292
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 3 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 4 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 5 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 6 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 7 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 15 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 16 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 17 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 18 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 19 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 20 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 21 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 22 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 23 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 24 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 25 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 26 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 27 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 28 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 29 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 30 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 31 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 32 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 33 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 34 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 35 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 36 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 37 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 38 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 39 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 40 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 44 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 50 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 51 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 52 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 53 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 54 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 55 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 56 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 57 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 58 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 59 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 60 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 61 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 62 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 63 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 64 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 65 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 66 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 67 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 68 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 72 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 73 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 74 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 75 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 76 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 77 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 78 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 79 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 80 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 81 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 82 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 83 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 84 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 85 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 86 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 87 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 88 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 89 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 90 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 91 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 92 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 93 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 94 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 95 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 96 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 97 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 98 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 99 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 100 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 101 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 102 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 103 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 104 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 105 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 106 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 107 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 108 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 109 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 110 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 111 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 112 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 113 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 114 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 115 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 116 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 117 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 118 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 119 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 120 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 121 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 122 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 123 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 124 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 125 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 126 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 127 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 128 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 129 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 130 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 131 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 132 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 133 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 134 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 135 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 136 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 137 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 138 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 139 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 140 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 141 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 142 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 143 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 144 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 145 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 146 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 147 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 148 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 149 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 150 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 151 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 152 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 153 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 154 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 155 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 156 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 157 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 158 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 159 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 160 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 161 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 162 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 163 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 164 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 165 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 166 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 167 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 168 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 169 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 170 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 171 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 172 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 173 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 174 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 175 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 176 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 177 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 178 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 179 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 180 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 181 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 182 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 183 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 184 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 185 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 186 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 187 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 188 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 189 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 190 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 191 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 192 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 193 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 194 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 195 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 196 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 197 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 198 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 199 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 200 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 201 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 202 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 203 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 204 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 205 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 206 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 207 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 208 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 209 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 210 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 211 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10000317 | 3300010882 | Bacteria | 44262 |
| 2 | Ga0160464_100127 | 3300012805 | Bacteria | 86084 |
| 3 | Ga0466701_049822 | 3300042598 | Bacteria | 24808 |
| 4 | Ga0466713_015935 | 3300042602 | Bacteria | 2359 |
| 5 | Ga0466716_372900 | 3300042605 | Bacteria | 2108 |
| 6 | Ga0160470_100374 | 3300012813 | Bacteria | 22445 |
| 7 | Ga0160440_100022 | 3300012815 | Bacteria | 270723 |
| 8 | Ga0160456_100239 | 3300012820 | Unclassified | 27715 |
| 9 | Ga0160456_100591 | 3300012820 | Unclassified | 10891 |
| 10 | Ga0160459_100120 | 3300012831 | Unclassified | 60956 |
| 11 | Ga0160458_102471 | 3300012832 | Bacteria | 2515 |
| 12 | Ga0160444_100053 | 3300012841 | Bacteria | 166531 |
| 13 | Ga0160444_100221 | 3300012841 | Unclassified | 49006 |
| 14 | Ga0160447_100400 | 3300012849 | Bacteria | 21508 |
| 15 | Ga0466690_109842 | 3300042590 | Bacteria | 9167 |
| 16 | Ga0466691_159396 | 3300042593 | Bacteria | 9478 |
| 17 | Ga0466695_225508 | 3300042595 | Bacteria | 3939 |
| 18 | Ga0466730_030162 | 3300042625 | Bacteria | 1792 |
| 19 | Ga0466704_184201 | 3300042643 | Bacteria | 2847 |
| 20 | Ga0466704_616674 | 3300042643 | Bacteria | 2343 |
| 21 | Ga0466725_370639 | 3300042654 | Bacteria | 3998 |
| 22 | Ga0466725_417003 | 3300042654 | Bacteria | 7426 |
| 23 | Ga0102734_1007291 | 3300007129 | Bacteria | 2496 |
| 24 | Ga0103264_1000480 | 3300007188 | Bacteria | 22479 |
| 25 | Ga0103264_1000918 | 3300007188 | Bacteria | 24747 |
| 26 | Ga0103264_1027914 | 3300007188 | Bacteria | 2645 |
| 27 | Ga0466701_025086 | 3300042598 | Bacteria | 26396 |
| 28 | Ga0160468_100034 | 3300012819 | Bacteria | 232419 |
| 29 | Ga0160467_100035 | 3300012829 | Bacteria | 221416 |
| 30 | Ga0466696_079449 | 3300042596 | Bacteria | 4106 |
| 31 | Ga0466730_023906 | 3300042625 | Bacteria | 118383 |
| 32 | Ga0466709_262544 | 3300042648 | Bacteria | 2208 |
| 33 | CVPL005W_1000591 | 3300002934 | Bacteria | 13531 |
| 34 | Ga0063521_1000019 | 3300003973 | Bacteria | 139495 |
| 35 | Ga0102736_1000500 | 3300007052 | Bacteria | 12005 |
| 36 | Ga0103261_1000127 | 3300007083 | Bacteria | 13703 |
| 37 | Ga0103264_1000005 | 3300007188 | Bacteria | 151532 |
| 38 | Ga0466710_003215 | 3300042613 | Unclassified | 26277 |
| 39 | Ga0466729_139503 | 3300042621 | Bacteria | 2906 |
| 40 | Ga0123356_10013280 | 3300010049 | Bacteria | 7958 |
| 41 | Ga0466701_045808 | 3300042598 | Bacteria | 3788 |
| 42 | Ga0466703_319537 | 3300042636 | Bacteria | 18153 |
| 43 | Ga0466724_67423 | 3300042649 | Bacteria | 11419 |
| 44 | Ga0466708_354131 | 3300042652 | Bacteria | 2934 |
| 45 | Ga0466725_129448 | 3300042654 | Bacteria | 92830 |
| 46 | 2227358553 | 2225789004 | Bacteria | 121621 |
| 47 | JGI24705J35276_12238357 | 3300002504 | Bacteria | 19944 |
| 48 | CVPL010W_10003108 | 3300002931 | Bacteria | 20947 |
| 49 | Ga0074278_109125 | 3300005721 | Bacteria | 5460 |
| 50 | Ga0102734_1000315 | 3300007129 | Bacteria | 14446 |
| 51 | Ga0103268_1002708 | 3300007192 | Unclassified | 3869 |
| 52 | Ga0466726_244774 | 3300042619 | Bacteria | 12649 |
| 53 | Ga0160471_100575 | 3300012812 | Unclassified | 9757 |
| 54 | Ga0466717_227339 | 3300042604 | Bacteria | 7911 |
| 55 | Ga0160459_103008 | 3300012831 | Unclassified | 2525 |
| 56 | Ga0160460_100085 | 3300012845 | Bacteria | 136620 |
| 57 | Ga0160433_100357 | 3300012846 | Bacteria | 26972 |
| 58 | Ga0466657_012444 | 3300042582 | Bacteria | 321104 |
| 59 | Ga0466734_016069 | 3300042623 | Bacteria | 26526 |
| 60 | Ga0466730_030029 | 3300042625 | Bacteria | 423027 |
| 61 | Ga0466724_46819 | 3300042649 | Bacteria | 306737 |
| 62 | Ga0466725_267511 | 3300042654 | Bacteria | 13384 |
| 63 | SCG598O02_11474 | 3300000460 | Bacteria | 36366 |
| 64 | JGI24705J35276_12222200 | 3300002504 | Bacteria | 2401 |
| 65 | Ga0102735_1000016 | 3300007080 | Bacteria | 52643 |
| 66 | Ga0102739_1003343 | 3300007095 | Bacteria | 2363 |
| 67 | Ga0104041_1000909 | 3300007106 | Bacteria | 17276 |
| 68 | Ga0102740_1001160 | 3300007140 | Bacteria | 6872 |
| 69 | Ga0102740_1002194 | 3300007140 | Unclassified | 4593 |
| 70 | Ga0102737_1000045 | 3300007142 | Bacteria | 35604 |
| 71 | Ga0103264_1001854 | 3300007188 | Bacteria | 9400 |
| 72 | Ga0103264_1019834 | 3300007188 | Bacteria | 3269 |
| 73 | Ga0103267_1000152 | 3300007190 | Bacteria | 27149 |
| 74 | Ga0123357_10000453 | 3300009784 | Bacteria | 39621 |
| 75 | Ga0160447_105302 | 3300012849 | Unclassified | 3628 |
| 76 | Ga0466696_270776 | 3300042596 | Bacteria | 14952 |
| 77 | Ga0466734_154274 | 3300042623 | Bacteria | 3243 |
| 78 | Ga0466724_55683 | 3300042649 | Bacteria | 8504 |
| 79 | Ga0466708_114385 | 3300042652 | Bacteria | 5417 |
| 80 | JGI24705J35276_12238350 | 3300002504 | Bacteria | 19798 |
| 81 | CVPL010W_10015023 | 3300002931 | Bacteria | 5701 |
| 82 | CVPL010W_10029078 | 3300002931 | Bacteria | 2325 |
| 83 | CVPL005W_1000448 | 3300002934 | Bacteria | 16571 |
| 84 | Ga0102739_1001096 | 3300007095 | Bacteria | 4620 |
| 85 | Ga0102737_1000442 | 3300007142 | Bacteria | 13669 |
| 86 | Ga0466715_312256 | 3300042616 | Bacteria | 2671 |
| 87 | Ga0466723_130492 | 3300042618 | Bacteria | 9199 |
| 88 | Ga0123354_10057799 | 3300010882 | Bacteria | 5773 |
| 89 | Ga0466701_016971 | 3300042598 | Unclassified | 71478 |
| 90 | Ga0160467_100238 | 3300012829 | Bacteria | 68691 |
| 91 | Ga0466693_066850 | 3300042592 | Bacteria | 2804 |
| 92 | Ga0466691_115414 | 3300042593 | Bacteria | 2077 |
| 93 | Ga0466703_175071 | 3300042636 | Bacteria | 2481 |
| 94 | Ga0466704_066993 | 3300042643 | Bacteria | 4630 |
| 95 | Ga0466724_16154 | 3300042649 | Bacteria | 19441 |
| 96 | Ga0466724_29704 | 3300042649 | Bacteria | 15292 |
| 97 | Ga0466724_63720 | 3300042649 | Bacteria | 129732 |
| 98 | CVPL010W_10023250 | 3300002931 | Unclassified | 3205 |
| 99 | CVPL010W_10028888 | 3300002931 | Bacteria | 2349 |
| 100 | Ga0103264_1021051 | 3300007188 | Bacteria | 3165 |
| 101 | Ga0103268_1000143 | 3300007192 | Bacteria | 45376 |
| 102 | Ga0466710_092386 | 3300042613 | Bacteria | 4378 |
| 103 | Ga0466710_247030 | 3300042613 | Bacteria | 5556 |
| 104 | Ga0466701_089505 | 3300042598 | Bacteria | 28812 |
| 105 | Ga0466722_016785 | 3300042609 | Bacteria | 14806 |
| 106 | Ga0530661_000967 | 3300056564 | Bacteria | 16957 |
| 107 | Ga0160431_100035 | 3300012828 | Bacteria | 118984 |
| 108 | Ga0160445_100092 | 3300012847 | Bacteria | 91124 |
| 109 | Ga0466734_005640 | 3300042623 | Bacteria | 2867 |
| 110 | Ga0466703_416603 | 3300042636 | Bacteria | 2744 |
| 111 | Ga0466708_261851 | 3300042652 | Bacteria | 27510 |
| 112 | Ga0466725_095288 | 3300042654 | Bacteria | 30521 |
| 113 | Ga0466725_398419 | 3300042654 | Bacteria | 4104 |
| 114 | CVPL010W_10000127 | 3300002931 | Bacteria | 74707 |
| 115 | CVPL010W_10009181 | 3300002931 | Bacteria | 9069 |
| 116 | CVPL005L_10001082 | 3300002938 | Bacteria | 37702 |
| 117 | Ga0102734_1009295 | 3300007129 | Bacteria | 2261 |
| 118 | Ga0103264_1000193 | 3300007188 | Bacteria | 58174 |
| 119 | Ga0103264_1000588 | 3300007188 | Bacteria | 17801 |
| 120 | Ga0123357_10000011 | 3300009784 | Bacteria | 173575 |
| 121 | Ga0123357_10000362 | 3300009784 | Bacteria | 42826 |
| 122 | Ga0466705_418382 | 3300042612 | Bacteria | 8300 |
| 123 | Ga0123354_10053566 | 3300010882 | Unclassified | 6067 |
| 124 | Ga0160464_100224 | 3300012805 | Unclassified | 55897 |
| 125 | Ga0466717_069670 | 3300042604 | Unclassified | 3394 |
| 126 | Ga0466722_004257 | 3300042609 | Bacteria | 4479 |
| 127 | Ga0160440_100074 | 3300012815 | Bacteria | 121934 |
| 128 | Ga0160459_100395 | 3300012831 | Bacteria | 18203 |
| 129 | Ga0160472_102220 | 3300012839 | Bacteria | 4569 |
| 130 | Ga0160445_100001 | 3300012847 | Bacteria | 765249 |
| 131 | Ga0466735_153631 | 3300042624 | Bacteria | 2730 |
| 132 | Ga0466704_012791 | 3300042643 | Bacteria | 8912 |
| 133 | Ga0466724_27834 | 3300042649 | Unclassified | 5930 |
| 134 | JGI24705J35276_12235965 | 3300002504 | Bacteria | 7233 |
| 135 | Ga0103266_1000001 | 3300007067 | Bacteria | 138973 |
| 136 | Ga0102737_1000403 | 3300007142 | Bacteria | 14574 |
| 137 | Ga0466715_018363 | 3300042616 | Bacteria | 4634 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF21162 | ETFQO_UQ-bd | ETF-QO, ubiquinone-binding | 261 | 354 | 0.98 |
| PF05187 | ETF_QO | Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S | 493 | 594 | 0.98 |
| PF01266 | DAO | FAD dependent oxidoreductase | 59 | 100 | 0.85 |
| PF13450 | NAD_binding_8 | NAD(P)-binding Rossmann-like domain | 62 | 107 | 0.85 |
| PF01946 | Thi4 | Thi4 family | 53 | 105 | 0.79 |
| PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 58 | 93 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05187 | GO:0051536 | iron-sulfur cluster binding | MF |
| PF07992 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.