Protein Family IF13993

Metagenome Isolate
183 Members
104 Samples
129 Scaffolds
257.24 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8073544309|8073549659|
Length
302 aa
Sequence
MGVRRTGMSGRDKAAKGGAEAGAARDGRARRFPSAGARLTAAIRHSGPYAAVRDAVYRMYEHRVEASLPTDITPRHVGVILDGNRRWARSMGLADVNHGHQRGADKISELLQWSTEAGVEHVTLWLLSTDNLNRPANELDPLLEIIENTVRKLADEGWHVKPVGALDLLPDKTARVLKDAGEATSGAPGLIVNVAVGYGGRREIADAVRSLLIEQASRGTSIEELAEGLEVEHIAEHLYTRGQPDPDLVIRTSGEQRLSGFMLWQSAHSEFYFCEVHWPDFRKVDFLRAMRSYAARHRRYGT

📊 Sample Types

Isolate 29.5%
Metagenome 70.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.5%
Termitidae 18.9%
Kalotermitidae 10.5%
Culicidae 6.3%
Tenebrionidae 6.3%
Formicidae 5.3%
Armadillidiidae 4.2%
Cambaridae 3.2%
Scarabaeidae 3.2%
Termopsidae 2.1%
Pentatomidae 1.1%
Rhinotermitidae 1.1%
Curculionidae 1.1%
Siricidae 1.1%
Apidae 1.1%
Thomisidae 1.1%
Hydrophilidae 1.1%
Hodotermitidae 1.1%
Cerambycidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
2 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
3 2912749649 Streptomyces sp. GS7 Isolate Termitidae
4 3006667155 Streptomyces sp. SID9727 Isolate
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
7 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
8 8062747827 Yimella sp. cx-51 Isolate Cambaridae
9 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
10 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
11 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
12 2896955351 Streptomyces sp. GF20 Isolate Termitidae
13 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
18 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
19 8073544309 Actinomadura sp. RB99 Isolate Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
23 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
24 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
25 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
26 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
27 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
28 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
29 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
35 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
36 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
37 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
38 2912817845 Streptomyces griseus SID164 Isolate
39 3006468911 Streptomyces sp. RB17 Isolate Termitidae
40 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
41 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
42 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
43 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
44 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
45 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
49 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
50 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
51 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
52 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
53 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
54 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
55 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
60 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
61 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
62 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
63 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
64 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
65 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
66 2862784999 Streptomyces sp. M41 Isolate Unclassified
67 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
68 2931425734 Nocardioides sp. J2M5 Isolate
69 2931430189 Tessaracoccus palaemonis J1M15 Isolate
70 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
71 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
72 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
73 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
74 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
75 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
76 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
77 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
78 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
79 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
80 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
81 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
82 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
83 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
84 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
85 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
86 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
87 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
88 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
89 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
90 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
91 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
92 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
93 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
94 2547132081 Streptomyces sp. S4 Isolate Formicidae
95 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
96 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
97 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
98 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
99 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
100 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
101 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
102 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
103 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
104 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_094966 3300042659 Bacteria 154982
2 Ga0562375_5300 3300056856 Unclassified 8062
3 Ga0562376_0498 3300056857 Unclassified 70540
4 Ga0466703_004651 3300042636 Bacteria 11603
5 Ga0466703_281077 3300042636 Bacteria 3368
6 Ga0123357_10027342 3300009784 Bacteria 7709
7 Ga0123356_10005052 3300010049 Bacteria 13524
8 Ga0123353_10001004 3300010167 Bacteria 34525
9 Ga0160454_100760 3300012798 Unclassified 6622
10 Ga0466707_322940 3300042601 Bacteria 1636
11 Ga0466713_048552 3300042602 Bacteria 14542
12 Ga0466713_133329 3300042602 Bacteria 19059
13 Ga0466717_184035 3300042604 Bacteria 2144
14 Ga0466719_331778 3300042606 Bacteria 6815
15 Ga0160446_107446 3300012835 Unclassified 1472
16 Ga0466705_197050 3300042612 Bacteria 2660
17 Ga0466705_299743 3300042612 Bacteria 5046
18 Ga0562379_4710 3300056790 Bacteria 6334
19 Ga0562376_4436 3300056857 Unclassified 11624
20 Ga0466723_242710 3300042618 Bacteria 13149
21 Ga0466729_268522 3300042621 Bacteria 1471
22 Ga0466730_087808 3300042625 Bacteria 2546
23 Ga0123357_10142102 3300009784 Bacteria 2946
24 Ga0123357_10156923 3300009784 Bacteria 2741
25 Ga0123354_10000054 3300010882 Bacteria 85368
26 Ga0102734_1007303 3300007129 Bacteria 3752
27 Ga0466706_010442 3300042599 Bacteria 11602
28 Ga0466706_011027 3300042599 Bacteria 7091
29 Ga0466706_185931 3300042599 Bacteria 87406
30 Ga0466713_111658 3300042602 Bacteria 8577
31 Ga0466714_125502 3300042603 Bacteria 1039
32 Ga0160435_1008191 3300012857 Unclassified 2260
33 Ga0160457_1002093 3300012858 Bacteria 4519
34 Ga0466696_122606 3300042596 Bacteria 2609
35 Ga0466723_050861 3300042618 Bacteria 2596
36 Ga0466723_180508 3300042618 Bacteria 5322
37 Ga0466703_168918 3300042636 Bacteria 44575
38 Ga0466703_356885 3300042636 Bacteria 58749
39 Ga0466704_384982 3300042643 Bacteria 8552
40 Ga0466704_571895 3300042643 Bacteria 129163
41 Ga0466727_166163 3300042655 Bacteria 9877
42 Ga0123357_10063600 3300009784 Bacteria 4934
43 Ga0123357_10336368 3300009784 Bacteria 1467
44 Ga0123353_10036528 3300010167 Bacteria 7696
45 Ga0123357_10000208 3300009784 Unclassified 55207
46 Ga0160431_100905 3300012828 Bacteria 9506
47 Ga0466723_258926 3300042618 Bacteria 6071
48 Ga0466723_284211 3300042618 Bacteria 1310
49 Ga0466734_102627 3300042623 Bacteria 3164
50 Ga0466703_113356 3300042636 Bacteria 1919
51 Ga0466704_603633 3300042643 Bacteria 17956
52 Ga0466727_164613 3300042655 Bacteria 1591
53 Ga0466727_221800 3300042655 Bacteria 5311
54 Ga0123357_10115815 3300009784 Unclassified 3396
55 Ga0123357_10208511 3300009784 Unclassified 2203
56 Ga0123356_10000557 3300010049 Bacteria 41411
57 Ga0123354_10001855 3300010882 Bacteria 26726
58 Ga0123354_10004061 3300010882 Bacteria 20559
59 Ga0123357_10000114 3300009784 Bacteria 68176
60 Ga0123357_10000336 3300009784 Bacteria 44505
61 Ga0123357_10000663 3300009784 Bacteria 34418
62 Ga0466713_006331 3300042602 Bacteria 40874
63 Ga0160432_100993 3300012818 Unclassified 11438
64 Ga0160469_100901 3300012824 Bacteria 10097
65 Ga0160458_108348 3300012832 Bacteria 1183
66 Ga0160430_101119 3300012852 Bacteria 10921
67 Ga0160448_100439 3300012854 Unclassified 14526
68 Ga0562379_0121 3300056790 Bacteria 248675
69 Ga0562374_2738 3300057007 Unclassified 13792
70 Ga0466715_017612 3300042616 Bacteria 40510
71 Ga0466729_241592 3300042621 Bacteria 1416
72 Ga0466704_057610 3300042643 Bacteria 40232
73 Ga0466708_127469 3300042652 Bacteria 1338
74 Ga0123356_10000026 3300010049 Bacteria 166166
75 Ga0466713_016641 3300042602 Bacteria 2001
76 Ga0466713_101616 3300042602 Bacteria 503322
77 Ga0466713_140916 3300042602 Bacteria 86854
78 Ga0160443_100185 3300012848 Bacteria 83494
79 Ga0160434_100830 3300012850 Bacteria 6780
80 Ga0160434_104396 3300012850 Bacteria 2351
81 Ga0160435_1014388 3300012857 Unclassified 1540
82 Ga0466656_059107 3300042550 Bacteria 1160
83 Ga0466696_153105 3300042596 Bacteria 2391
84 Ga0466733_170547 3300042659 Bacteria 11587
85 Ga0562376_6057 3300056857 Unclassified 6357
86 Ga0466705_435653 3300042612 Unclassified 13444
87 Ga0466730_001963 3300042625 Bacteria 14420
88 Ga0466707_080865 3300042601 Bacteria 320076
89 Ga0466707_152946 3300042601 Bacteria 9067
90 Ga0466713_033280 3300042602 Bacteria 2446
91 Ga0466713_110586 3300042602 Bacteria 2209
92 Ga0466713_146266 3300042602 Bacteria 1828
93 Ga0160441_100125 3300012825 Bacteria 87923
94 Ga0160436_1000116 3300012861 Bacteria 39726
95 Ga0466696_171698 3300042596 Bacteria 2274
96 Ga0466733_139768 3300042659 Bacteria 10013
97 Ga0562375_0028 3300056856 Bacteria 708255
98 Ga0562375_1926 3300056856 Bacteria 25333
99 Ga0562376_0062 3300056857 Unclassified 278564
100 Ga0562376_5396 3300056857 Unclassified 8400
101 Ga0466723_371127 3300042618 Bacteria 5898
102 Ga0466728_337395 3300042620 Bacteria 2137
103 Ga0466703_071015 3300042636 Bacteria 6854
104 Ga0123357_10026561 3300009784 Bacteria 7819
105 Ga0123357_10267795 3300009784 Bacteria 1792
106 Ga0123356_10018009 3300010049 Bacteria 6709
107 Ga0466706_091482 3300042599 Bacteria 1319
108 Ga0466713_028068 3300042602 Bacteria 14905
109 Ga0466719_107421 3300042606 Bacteria 1608
110 Ga0466698_215113 3300042610 Bacteria 3850
111 Ga0160446_110496 3300012835 Bacteria 1179
112 Ga0466697_218185 3300042611 Bacteria 10632
113 Ga0466705_299157 3300042612 Bacteria 7434
114 Ga0562378_2484 3300056814 Unclassified 15070
115 Ga0562375_1015 3300056856 Bacteria 44532
116 Ga0562374_0070 3300057007 Unclassified 326205
117 Ga0466723_185049 3300042618 Bacteria 21662
118 Ga0466726_142835 3300042619 Bacteria 1595
119 Ga0466730_095917 3300042625 Bacteria 2153
120 Ga0466725_178306 3300042654 Bacteria 1961
121 Ga0123357_10095253 3300009784 Bacteria 3861
122 Ga0123356_10048269 3300010049 Bacteria 3962
123 Ga0466707_136564 3300042601 Bacteria 8450
124 Ga0466713_085668 3300042602 Bacteria 2540
125 Ga0466713_114296 3300042602 Bacteria 44791
126 Ga0160445_107476 3300012847 Bacteria 1725
127 Ga0160436_1014572 3300012861 Bacteria 1609
128 Ga0466691_086975 3300042593 Bacteria 21324
129 Ga0466696_065968 3300042596 Bacteria 11288

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase 80 301 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01255 GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.