Protein Family IF13878
Metagenome
Isolate
153
Members
44
Samples
147
Scaffolds
101.31
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8030343600|8030344754|
- Length
- 102 aa
- Sequence
- MHVKKGDTVVIISGKDKGKKGKILAAMPKEDRVIVEGINMLTKHKKPSGQMQQGGIIHQEGPIHVSNVMLYCNKDKTGVRVGQKVLDNGDKVRVCKKCGEVL
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.6%
Kalotermitidae
25.6%
Unclassified
16.3%
Termopsidae
9.3%
Rhinotermitidae
7.0%
Hodotermitidae
2.3%
Blattidae
2.3%
Stratiomyidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 4 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 16 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 36 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 37 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 38 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 39 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10269242 | 3300010049 | Bacteria | 1792 |
| 2 | Ga0123353_10120176 | 3300010167 | Bacteria | 4225 |
| 3 | Ga0123353_10667545 | 3300010167 | Bacteria | 1467 |
| 4 | Ga0123353_10727862 | 3300010167 | Bacteria | 1386 |
| 5 | Ga0123353_10941172 | 3300010167 | Bacteria | 1170 |
| 6 | Ga0123353_11179433 | 3300010167 | Bacteria | 1007 |
| 7 | Ga0123353_11893588 | 3300010167 | Unclassified | 736 |
| 8 | Ga0466727_049934 | 3300042655 | Bacteria | 1036 |
| 9 | Ga0466700_400353 | 3300042600 | Bacteria | 1553 |
| 10 | Ga0466707_098926 | 3300042601 | Bacteria | 16720 |
| 11 | Ga0466719_239926 | 3300042606 | Bacteria | 3087 |
| 12 | Ga0466722_238982 | 3300042609 | Bacteria | 5314 |
| 13 | Ga0466690_029507 | 3300042590 | Bacteria | 2424 |
| 14 | Ga0466696_232378 | 3300042596 | Bacteria | 6933 |
| 15 | Ga0466696_491940 | 3300042596 | Bacteria | 4756 |
| 16 | Ga0466705_244395 | 3300042612 | Bacteria | 7115 |
| 17 | Ga0123357_10349478 | 3300009784 | Unclassified | 1417 |
| 18 | Ga0123356_10011738 | 3300010049 | Bacteria | 8528 |
| 19 | Ga0123356_10031620 | 3300010049 | Bacteria | 4952 |
| 20 | Ga0123356_12303743 | 3300010049 | Unclassified | 673 |
| 21 | Ga0123356_13353442 | 3300010049 | Unclassified | 556 |
| 22 | Ga0123353_10579676 | 3300010167 | Bacteria | 1610 |
| 23 | Ga0123353_10823268 | 3300010167 | Bacteria | 1278 |
| 24 | Ga0123354_10254821 | 3300010882 | Bacteria | 1768 |
| 25 | Ga0466729_223134 | 3300042621 | Bacteria | 15957 |
| 26 | Ga0466729_243888 | 3300042621 | Bacteria | 4126 |
| 27 | Ga0466735_178465 | 3300042624 | Bacteria | 1256 |
| 28 | Ga0466703_351353 | 3300042636 | Bacteria | 1505 |
| 29 | Ga0466704_388849 | 3300042643 | Unclassified | 3618 |
| 30 | Ga0466708_352569 | 3300042652 | Bacteria | 2310 |
| 31 | Ga0466711_259889 | 3300042615 | Bacteria | 3347 |
| 32 | Ga0466728_254102 | 3300042620 | Bacteria | 9162 |
| 33 | Ga0466700_223191 | 3300042600 | Bacteria | 1184 |
| 34 | Ga0466713_128565 | 3300042602 | Bacteria | 50941 |
| 35 | Ga0466719_154671 | 3300042606 | Bacteria | 7680 |
| 36 | Ga0466722_072253 | 3300042609 | Bacteria | 3358 |
| 37 | Ga0466656_100722 | 3300042550 | Bacteria | 1203 |
| 38 | Ga0466696_359722 | 3300042596 | Bacteria | 2646 |
| 39 | Ga0466696_439602 | 3300042596 | Bacteria | 1028 |
| 40 | JGI24702J35022_10027741 | 3300002462 | Bacteria | 3045 |
| 41 | Ga0123356_10222090 | 3300010049 | Unclassified | 1946 |
| 42 | Ga0123356_11355260 | 3300010049 | Bacteria | 873 |
| 43 | Ga0123353_10456446 | 3300010167 | Bacteria | 1879 |
| 44 | Ga0123353_11426529 | 3300010167 | Unclassified | 888 |
| 45 | Ga0123353_12579120 | 3300010167 | Bacteria | 602 |
| 46 | Ga0123354_10161046 | 3300010882 | Bacteria | 2664 |
| 47 | Ga0466703_132134 | 3300042636 | Bacteria | 9668 |
| 48 | Ga0466704_101451 | 3300042643 | Bacteria | 28867 |
| 49 | Ga0466704_353103 | 3300042643 | Bacteria | 17158 |
| 50 | Ga0466726_091622 | 3300042619 | Bacteria | 2422 |
| 51 | Ga0466726_252863 | 3300042619 | Unclassified | 1442 |
| 52 | Ga0466707_048054 | 3300042601 | Bacteria | 11948 |
| 53 | Ga0466707_164538 | 3300042601 | Bacteria | 30398 |
| 54 | Ga0466707_406957 | 3300042601 | Bacteria | 2995 |
| 55 | Ga0466696_120880 | 3300042596 | Bacteria | 1573 |
| 56 | Ga0466696_181222 | 3300042596 | Bacteria | 9794 |
| 57 | Ga0466696_371950 | 3300042596 | Bacteria | 1662 |
| 58 | Ga0068305_10059637 | 3300005083 | Bacteria | 5268 |
| 59 | Ga0123357_10098417 | 3300009784 | Bacteria | 3781 |
| 60 | Ga0123356_10709277 | 3300010049 | Bacteria | 1175 |
| 61 | Ga0123356_11967635 | 3300010049 | Bacteria | 729 |
| 62 | Ga0123356_13412519 | 3300010049 | Bacteria | 551 |
| 63 | Ga0123353_10321937 | 3300010167 | Bacteria | 2346 |
| 64 | Ga0123353_10410512 | 3300010167 | Bacteria | 2011 |
| 65 | Ga0123354_10033652 | 3300010882 | Bacteria | 8022 |
| 66 | Ga0466704_013130 | 3300042643 | Bacteria | 1334 |
| 67 | Ga0466704_115820 | 3300042643 | Bacteria | 1673 |
| 68 | Ga0466705_408161 | 3300042612 | Bacteria | 2872 |
| 69 | Ga0466710_035983 | 3300042613 | Bacteria | 1011 |
| 70 | Ga0466726_060368 | 3300042619 | Bacteria | 11472 |
| 71 | Ga0466726_364461 | 3300042619 | Bacteria | 33247 |
| 72 | Ga0466700_071403 | 3300042600 | Bacteria | 3021 |
| 73 | Ga0466714_096655 | 3300042603 | Bacteria | 2501 |
| 74 | Ga0466694_177824 | 3300042594 | Bacteria | 2140 |
| 75 | Ga0466697_234920 | 3300042611 | Bacteria | 1787 |
| 76 | Ga0466733_212456 | 3300042659 | Bacteria | 1887 |
| 77 | Ga0123356_10052454 | 3300010049 | Bacteria | 3794 |
| 78 | Ga0123356_10247758 | 3300010049 | Bacteria | 1857 |
| 79 | Ga0123356_11116046 | 3300010049 | Bacteria | 957 |
| 80 | Ga0123356_12017613 | 3300010049 | Bacteria | 720 |
| 81 | Ga0123353_10000274 | 3300010167 | Bacteria | 64224 |
| 82 | Ga0123353_11343906 | 3300010167 | Bacteria | 924 |
| 83 | Ga0123353_12127413 | 3300010167 | Bacteria | 682 |
| 84 | Ga0123353_12342000 | 3300010167 | Unclassified | 641 |
| 85 | Ga0466703_242531 | 3300042636 | Bacteria | 1200 |
| 86 | Ga0466703_419521 | 3300042636 | Bacteria | 2273 |
| 87 | Ga0466708_403608 | 3300042652 | Bacteria | 1352 |
| 88 | Ga0466727_131483 | 3300042655 | Bacteria | 12506 |
| 89 | Ga0466715_472158 | 3300042616 | Bacteria | 4829 |
| 90 | Ga0466700_473806 | 3300042600 | Bacteria | 1054 |
| 91 | Ga0466707_118478 | 3300042601 | Bacteria | 1064 |
| 92 | Ga0466714_039083 | 3300042603 | Bacteria | 1647 |
| 93 | Ga0466696_224942 | 3300042596 | Bacteria | 1019 |
| 94 | Ga0466697_267152 | 3300042611 | Unclassified | 2000 |
| 95 | Ga0466705_277055 | 3300042612 | Bacteria | 1000 |
| 96 | Ga0123356_10125678 | 3300010049 | Bacteria | 2503 |
| 97 | Ga0123353_11470789 | 3300010167 | Bacteria | 870 |
| 98 | Ga0123353_12045482 | 3300010167 | Bacteria | 700 |
| 99 | Ga0123354_11057483 | 3300010882 | Bacteria | 518 |
| 100 | Ga0466703_133878 | 3300042636 | Bacteria | 3305 |
| 101 | Ga0466708_215601 | 3300042652 | Bacteria | 8054 |
| 102 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 103 | Ga0466707_200598 | 3300042601 | Bacteria | 1094 |
| 104 | Ga0466707_243752 | 3300042601 | Bacteria | 10455 |
| 105 | Ga0466707_414149 | 3300042601 | Bacteria | 1425 |
| 106 | Ga0466713_008709 | 3300042602 | Bacteria | 25958 |
| 107 | Ga0466719_130446 | 3300042606 | Bacteria | 3854 |
| 108 | Ga0466692_196296 | 3300042591 | Bacteria | 21527 |
| 109 | Ga0466693_447738 | 3300042592 | Bacteria | 1135 |
| 110 | JGI24705J35276_12238163 | 3300002504 | Bacteria | 16705 |
| 111 | Ga0068302_10021184 | 3300005071 | Bacteria | 4651 |
| 112 | Ga0466697_090522 | 3300042611 | Bacteria | 1830 |
| 113 | Ga0123357_10008010 | 3300009784 | Bacteria | 13145 |
| 114 | Ga0123356_10122111 | 3300010049 | Bacteria | 2536 |
| 115 | Ga0123353_10064388 | 3300010167 | Bacteria | 5883 |
| 116 | Ga0123353_10124877 | 3300010167 | Bacteria | 4136 |
| 117 | Ga0123354_10161207 | 3300010882 | Bacteria | 2662 |
| 118 | Ga0123354_10768245 | 3300010882 | Bacteria | 656 |
| 119 | Ga0466726_380315 | 3300042619 | Bacteria | 17436 |
| 120 | Ga0466728_256221 | 3300042620 | Bacteria | 3113 |
| 121 | Ga0466707_310348 | 3300042601 | Bacteria | 1789 |
| 122 | Ga0466716_161782 | 3300042605 | Bacteria | 1797 |
| 123 | Ga0466719_113129 | 3300042606 | Bacteria | 1563 |
| 124 | Ga0265387_1074845 | 3300024582 | Bacteria | 660 |
| 125 | Ga0466692_151313 | 3300042591 | Bacteria | 9518 |
| 126 | 2227414160 | 2225789004 | Bacteria | 5671 |
| 127 | JGI24705J35276_11586001 | 3300002504 | Bacteria | 586 |
| 128 | Ga0466705_342461 | 3300042612 | Bacteria | 4908 |
| 129 | Ga0123356_10062470 | 3300010049 | Bacteria | 3479 |
| 130 | Ga0123356_10222594 | 3300010049 | Bacteria | 1945 |
| 131 | Ga0123356_10269377 | 3300010049 | Bacteria | 1792 |
| 132 | Ga0123353_10850044 | 3300010167 | Bacteria | 1251 |
| 133 | Ga0123353_11287420 | 3300010167 | Bacteria | 950 |
| 134 | Ga0123354_10059695 | 3300010882 | Bacteria | 5653 |
| 135 | Ga0466704_084314 | 3300042643 | Bacteria | 2183 |
| 136 | Ga0466715_238140 | 3300042616 | Bacteria | 1220 |
| 137 | Ga0466715_484303 | 3300042616 | Bacteria | 3194 |
| 138 | Ga0466728_155355 | 3300042620 | Bacteria | 2584 |
| 139 | Ga0466729_064076 | 3300042621 | Bacteria | 3236 |
| 140 | Ga0466706_185807 | 3300042599 | Bacteria | 5521 |
| 141 | Ga0466713_039885 | 3300042602 | Bacteria | 1109 |
| 142 | Ga0466719_528471 | 3300042606 | Bacteria | 3008 |
| 143 | Ga0466722_250136 | 3300042609 | Bacteria | 3071 |
| 144 | Ga0466696_179260 | 3300042596 | Bacteria | 1274 |
| 145 | Ga0466696_252118 | 3300042596 | Bacteria | 6477 |
| 146 | JGI24705J35276_11946337 | 3300002504 | Bacteria | 791 |
| 147 | JGI24705J35276_12156176 | 3300002504 | Bacteria | 1208 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.