Protein Family IF13649
Metagenome
Isolate
171
Members
82
Samples
95
Scaffolds
255.8
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8007211731|8007211770|
- Length
- 252 aa
- Sequence
- MNELIRIDNVEKYYGNKGSTTKALNRVSFSVNEGEFTGIMGTSGSGKTTLLNMLATIDRVSAGHIFFDNQDITQFDENRLAQFRKENLGFIFQDFNLLDTLTLEENITLALSLQVGKGAAPDRVKRMMEQLGIYELKEKFPYEVSGGQKQRCACARALITEAKLILADEPTGALDSKSSAMLLETMEKMNREMAATILMVTHDAFSASYCNRILFLSDGEVFQELYKGDRTRREFLNEILDVLAAIGGDGHA
Sample Types
Isolate
44.4%
Metagenome
55.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
20.0%
Unclassified
18.8%
Kalotermitidae
15.0%
Termitidae
10.0%
Pyralidae
7.5%
Apidae
5.0%
Scarabaeidae
3.8%
Drosophilidae
2.5%
Passalidae
2.5%
Noctuidae
1.2%
Eresidae
1.2%
Culicidae
1.2%
Hydrophilidae
1.2%
Rhinotermitidae
1.2%
Hodotermitidae
1.2%
Elmidae
1.2%
Ocypodidae
1.2%
Portunidae
1.2%
Pyrrhocoridae
1.2%
Dytiscidae
1.2%
Bombycidae
1.2%
Taxonomy
Archaea
0
Bacteria
166
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 2 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 3 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 4 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 5 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 13 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 14 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 15 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 16 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 19 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 20 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 21 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 25 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 26 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 27 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 28 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 34 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 35 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 38 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 39 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 40 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 41 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 42 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 43 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 44 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 45 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 46 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 47 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 54 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 55 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 56 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 57 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 58 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 59 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 60 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 64 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 65 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 66 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 67 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 68 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 69 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 70 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 71 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 72 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 73 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 74 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 75 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 76 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 77 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 78 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 79 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 80 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 81 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 82 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_232328 | 3300042612 | Bacteria | 12694 |
| 2 | Ga0466704_185909 | 3300042643 | Bacteria | 5473 |
| 3 | Ga0466704_304756 | 3300042643 | Bacteria | 24532 |
| 4 | Ga0466708_267285 | 3300042652 | Bacteria | 10460 |
| 5 | Ga0466696_266092 | 3300042596 | Bacteria | 3474 |
| 6 | Ga0123355_10281392 | 3300009826 | Bacteria | 2296 |
| 7 | 2227476860 | 2225789004 | Bacteria | 4603 |
| 8 | Ga0068305_10021974 | 3300005083 | Unclassified | 2564 |
| 9 | Ga0466715_152691 | 3300042616 | Bacteria | 26393 |
| 10 | Ga0466715_219688 | 3300042616 | Bacteria | 8301 |
| 11 | Ga0466715_466462 | 3300042616 | Bacteria | 20312 |
| 12 | Ga0466713_014011 | 3300042602 | Unclassified | 20555 |
| 13 | Ga0466716_426094 | 3300042605 | Bacteria | 4977 |
| 14 | Ga0466719_068610 | 3300042606 | Bacteria | 16953 |
| 15 | Ga0466733_117877 | 3300042659 | Bacteria | 1133 |
| 16 | Ga0466709_285069 | 3300042648 | Unclassified | 70923 |
| 17 | Ga0466696_293304 | 3300042596 | Bacteria | 4438 |
| 18 | Ga0123355_10355220 | 3300009826 | Bacteria | 1937 |
| 19 | Ga0123355_10397440 | 3300009826 | Bacteria | 1781 |
| 20 | Ga0123355_10656927 | 3300009826 | Bacteria | 1221 |
| 21 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 22 | Ga0466711_220285 | 3300042615 | Bacteria | 1986 |
| 23 | Ga0466707_368690 | 3300042601 | Bacteria | 1367 |
| 24 | Ga0466713_132591 | 3300042602 | Bacteria | 1375 |
| 25 | Ga0466714_027576 | 3300042603 | Bacteria | 2838 |
| 26 | Ga0466705_126235 | 3300042612 | Bacteria | 1577 |
| 27 | Ga0466705_348253 | 3300042612 | Bacteria | 14158 |
| 28 | Ga0466704_068230 | 3300042643 | Bacteria | 4969 |
| 29 | Ga0466708_244736 | 3300042652 | Bacteria | 48007 |
| 30 | Ga0466696_163079 | 3300042596 | Bacteria | 28069 |
| 31 | 2227494065 | 2225789004 | Unclassified | 20366 |
| 32 | IMNBL1DRAFT_c0007544 | 3300000062 | Bacteria | 5699 |
| 33 | Ga0466715_089915 | 3300042616 | Bacteria | 43716 |
| 34 | Ga0466706_077951 | 3300042599 | Bacteria | 12692 |
| 35 | Ga0466700_171772 | 3300042600 | Bacteria | 1841 |
| 36 | Ga0466714_086251 | 3300042603 | Bacteria | 5567 |
| 37 | Ga0466705_209152 | 3300042612 | Bacteria | 3207 |
| 38 | Ga0466705_330043 | 3300042612 | Bacteria | 2132 |
| 39 | Ga0466692_183108 | 3300042591 | Bacteria | 27748 |
| 40 | Ga0466696_256712 | 3300042596 | Bacteria | 4304 |
| 41 | IMNBL1DRAFT_c0004082 | 3300000062 | Bacteria | 8935 |
| 42 | IMNBL1DRAFT_c0005619 | 3300000062 | Bacteria | 7108 |
| 43 | Ga0466728_107846 | 3300042620 | Bacteria | 2894 |
| 44 | Ga0466701_016488 | 3300042598 | Bacteria | 1515 |
| 45 | Ga0466701_034989 | 3300042598 | Bacteria | 113580 |
| 46 | Ga0466700_116630 | 3300042600 | Bacteria | 3481 |
| 47 | Ga0466714_060163 | 3300042603 | Bacteria | 3300 |
| 48 | Ga0466714_165102 | 3300042603 | Bacteria | 1133 |
| 49 | Ga0466705_257460 | 3300042612 | Bacteria | 5846 |
| 50 | Ga0466704_328778 | 3300042643 | Bacteria | 87564 |
| 51 | Ga0466704_372743 | 3300042643 | Bacteria | 4522 |
| 52 | Ga0466704_518331 | 3300042643 | Bacteria | 4875 |
| 53 | IMNBL1DRAFT_c0019857 | 3300000062 | Bacteria | 2739 |
| 54 | Ga0466711_020152 | 3300042615 | Bacteria | 2771 |
| 55 | Ga0466711_393058 | 3300042615 | Bacteria | 11244 |
| 56 | Ga0466707_380442 | 3300042601 | Bacteria | 4722 |
| 57 | Ga0466714_073462 | 3300042603 | Bacteria | 5925 |
| 58 | Ga0466719_343566 | 3300042606 | Bacteria | 3056 |
| 59 | Ga0466705_129969 | 3300042612 | Bacteria | 4377 |
| 60 | Ga0466705_348789 | 3300042612 | Bacteria | 31493 |
| 61 | Ga0466704_561369 | 3300042643 | Bacteria | 3874 |
| 62 | Ga0466709_197930 | 3300042648 | Bacteria | 40156 |
| 63 | Ga0466696_122928 | 3300042596 | Bacteria | 1168 |
| 64 | Ga0466696_342854 | 3300042596 | Bacteria | 1932 |
| 65 | Ga0466696_411985 | 3300042596 | Bacteria | 2473 |
| 66 | 2227358600 | 2225789004 | Bacteria | 6119 |
| 67 | Ga0072941_1068509 | 3300005201 | Bacteria | 10516 |
| 68 | Ga0466705_407214 | 3300042612 | Bacteria | 20230 |
| 69 | Ga0466705_528014 | 3300042612 | Bacteria | 3193 |
| 70 | Ga0466715_424647 | 3300042616 | Bacteria | 16290 |
| 71 | Ga0466707_206115 | 3300042601 | Unclassified | 2113 |
| 72 | Ga0466707_231600 | 3300042601 | Bacteria | 14339 |
| 73 | Ga0466714_115804 | 3300042603 | Bacteria | 1999 |
| 74 | Ga0466705_344612 | 3300042612 | Bacteria | 82908 |
| 75 | Ga0466703_076568 | 3300042636 | Bacteria | 3547 |
| 76 | IMNBL1DRAFT_c0010119 | 3300000062 | Bacteria | 4562 |
| 77 | JGI24697J35500_11202868 | 3300002507 | Bacteria | 1688 |
| 78 | Ga0466711_349078 | 3300042615 | Bacteria | 6056 |
| 79 | Ga0466700_003366 | 3300042600 | Bacteria | 1118 |
| 80 | Ga0466714_016617 | 3300042603 | Bacteria | 2316 |
| 81 | Ga0466714_093868 | 3300042603 | Bacteria | 1344 |
| 82 | Ga0466714_102799 | 3300042603 | Bacteria | 1150 |
| 83 | Ga0466714_160600 | 3300042603 | Bacteria | 4029 |
| 84 | Ga0466690_125176 | 3300042590 | Bacteria | 3151 |
| 85 | Ga0466692_070944 | 3300042591 | Bacteria | 44137 |
| 86 | Ga0466696_172163 | 3300042596 | Bacteria | 3942 |
| 87 | Ga0466696_262556 | 3300042596 | Bacteria | 2529 |
| 88 | Ga0123355_10043960 | 3300009826 | Bacteria | 7268 |
| 89 | Ga0123355_10108222 | 3300009826 | Bacteria | 4353 |
| 90 | Ga0123355_10146494 | 3300009826 | Bacteria | 3599 |
| 91 | IMNBL1DRAFT_c0001807 | 3300000062 | Bacteria | 15578 |
| 92 | Ga0466715_207031 | 3300042616 | Bacteria | 3368 |
| 93 | Ga0466715_587283 | 3300042616 | Bacteria | 11003 |
| 94 | Ga0466707_362351 | 3300042601 | Bacteria | 47572 |
| 95 | Ga0466719_371032 | 3300042606 | Bacteria | 8953 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 24 | 171 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.