Protein Family IF13494
Metagenome
Isolate
170
Members
52
Samples
162
Scaffolds
449.97
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|643348524|643423197|
- Length
- 493 aa
- Sequence
- MLYGKNSVWNTLDWLTVRVYLVLVLIGWFCIYAASYECNTGRFDFSNRASMQMVWILSSLCIAFVLLMIEGNWYEVFAFGIYIAVMLLLIVTVFVATPIKGSCSWLTLGAVRIQPAEFAKFATALAVAKVMGRYQFDISKKRSIISLLGLVFLPISLILLQRETGSALVFFVFFLVFYREGMSGKILLIGFSAALIFVLVVRFPFVVVSSISCGELLGMGFIIFCVMGLLLQYNYSRELKHVKYLFCAVLGTTVVSISMFLFTSFNVYWIILSFFVSICFYFLFLFMKNRFSIYLWIVLFIIGSFSFLYSTDYIFDNVLELHQKNRVQVALGIIDDPRGAGYNVNQSKIAIGSGGFKGKGYLRGTQTELKYVPEQETDFIFCTLGEEMGFIGSVTVLVLFLILIIRLVWLAEKQQRVFIRVYGYSVACIIFFHFAINIGMVLGITPVIGIPLSFLSYGGSSLWSFTILLFIFLRLDTSKRFGKGDLLKFKFST
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Kalotermitidae
28.0%
Unclassified
12.0%
Rhinotermitidae
8.0%
Blattidae
6.0%
Termopsidae
6.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 34 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 37 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_072653 | 3300042615 | Bacteria | 7639 |
| 2 | Ga0466711_364135 | 3300042615 | Bacteria | 3426 |
| 3 | Ga0466723_094954 | 3300042618 | Bacteria | 8294 |
| 4 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 5 | Ga0466690_228138 | 3300042590 | Bacteria | 28377 |
| 6 | JGI24705J35276_12223232 | 3300002504 | Bacteria | 2489 |
| 7 | Ga0466735_032969 | 3300042624 | Bacteria | 2300 |
| 8 | Ga0466735_154777 | 3300042624 | Bacteria | 5853 |
| 9 | Ga0466703_040410 | 3300042636 | Bacteria | 7418 |
| 10 | Ga0466704_295450 | 3300042643 | Bacteria | 5382 |
| 11 | Ga0466708_138945 | 3300042652 | Bacteria | 5124 |
| 12 | Ga0466727_224853 | 3300042655 | Bacteria | 23233 |
| 13 | Ga0466701_020502 | 3300042598 | Bacteria | 10007 |
| 14 | Ga0466713_048475 | 3300042602 | Bacteria | 59892 |
| 15 | Ga0466713_109474 | 3300042602 | Bacteria | 12788 |
| 16 | Ga0466697_151232 | 3300042611 | Bacteria | 4098 |
| 17 | Ga0466728_202712 | 3300042620 | Bacteria | 29942 |
| 18 | Ga0466728_404528 | 3300042620 | Bacteria | 20672 |
| 19 | Ga0123357_10003779 | 3300009784 | Bacteria | 17515 |
| 20 | Ga0123357_10117947 | 3300009784 | Bacteria | 3356 |
| 21 | Ga0123353_10373771 | 3300010167 | Bacteria | 2135 |
| 22 | Ga0466690_087203 | 3300042590 | Bacteria | 24182 |
| 23 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 24 | Ga0466696_399809 | 3300042596 | Bacteria | 6340 |
| 25 | Ga0466703_072411 | 3300042636 | Bacteria | 7818 |
| 26 | Ga0466703_419148 | 3300042636 | Bacteria | 10322 |
| 27 | Ga0466704_079126 | 3300042643 | Bacteria | 6576 |
| 28 | Ga0466704_367739 | 3300042643 | Bacteria | 6973 |
| 29 | Ga0466709_111041 | 3300042648 | Bacteria | 3738 |
| 30 | Ga0466708_189765 | 3300042652 | Bacteria | 2843 |
| 31 | Ga0466701_061376 | 3300042598 | Bacteria | 5771 |
| 32 | Ga0466700_303542 | 3300042600 | Bacteria | 18342 |
| 33 | Ga0466707_087930 | 3300042601 | Bacteria | 9677 |
| 34 | Ga0466707_196186 | 3300042601 | Bacteria | 9688 |
| 35 | Ga0466707_383728 | 3300042601 | Bacteria | 16507 |
| 36 | Ga0466713_119093 | 3300042602 | Bacteria | 59442 |
| 37 | Ga0466714_101031 | 3300042603 | Bacteria | 79046 |
| 38 | Ga0466716_085091 | 3300042605 | Bacteria | 17694 |
| 39 | Ga0466733_164143 | 3300042659 | Bacteria | 4108 |
| 40 | Ga0466710_126297 | 3300042613 | Bacteria | 2244 |
| 41 | Ga0466711_034154 | 3300042615 | Bacteria | 9934 |
| 42 | Ga0466711_045368 | 3300042615 | Bacteria | 43229 |
| 43 | Ga0466715_192873 | 3300042616 | Bacteria | 10969 |
| 44 | Ga0466718_032068 | 3300042617 | Bacteria | 2136 |
| 45 | Ga0466723_128730 | 3300042618 | Bacteria | 22067 |
| 46 | Ga0466723_236631 | 3300042618 | Bacteria | 23560 |
| 47 | Ga0466729_039119 | 3300042621 | Bacteria | 17456 |
| 48 | Ga0466729_077009 | 3300042621 | Bacteria | 32046 |
| 49 | Ga0123357_10009748 | 3300009784 | Bacteria | 12140 |
| 50 | Ga0123356_10015385 | 3300010049 | Bacteria | 7337 |
| 51 | Ga0123353_10377628 | 3300010167 | Bacteria | 2122 |
| 52 | Ga0123354_10023390 | 3300010882 | Bacteria | 9747 |
| 53 | Ga0456237_0000006 | 3300041968 | Bacteria | 62306 |
| 54 | Ga0466690_335963 | 3300042590 | Bacteria | 14238 |
| 55 | Ga0466692_151517 | 3300042591 | Bacteria | 8533 |
| 56 | Ga0466691_179044 | 3300042593 | Bacteria | 2337 |
| 57 | Ga0466694_386233 | 3300042594 | Bacteria | 8172 |
| 58 | Ga0466696_132281 | 3300042596 | Bacteria | 5658 |
| 59 | Ga0466696_246530 | 3300042596 | Bacteria | 6131 |
| 60 | IMNBL1DRAFT_c0000312 | 3300000062 | Bacteria | 41387 |
| 61 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 62 | Ga0466704_304995 | 3300042643 | Bacteria | 7216 |
| 63 | Ga0466713_123497 | 3300042602 | Bacteria | 4888 |
| 64 | Ga0466722_006046 | 3300042609 | Bacteria | 2735 |
| 65 | Ga0466705_365178 | 3300042612 | Bacteria | 12901 |
| 66 | Ga0466705_477179 | 3300042612 | Bacteria | 3225 |
| 67 | Ga0466711_298234 | 3300042615 | Bacteria | 16638 |
| 68 | Ga0466715_403406 | 3300042616 | Bacteria | 13428 |
| 69 | Ga0466723_059293 | 3300042618 | Bacteria | 11190 |
| 70 | Ga0466726_181310 | 3300042619 | Bacteria | 18208 |
| 71 | Ga0466728_063056 | 3300042620 | Bacteria | 68416 |
| 72 | Ga0123357_10098360 | 3300009784 | Unclassified | 3782 |
| 73 | Ga0123354_10217727 | 3300010882 | Bacteria | 2040 |
| 74 | Ga0466692_085644 | 3300042591 | Bacteria | 19062 |
| 75 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 76 | Ga0466696_235371 | 3300042596 | Bacteria | 2104 |
| 77 | 2227228034 | 2225789004 | Bacteria | 7379 |
| 78 | IMNBL1DRAFT_c0000802 | 3300000062 | Bacteria | 24738 |
| 79 | IMNBL1DRAFT_c0004041 | 3300000062 | Bacteria | 9008 |
| 80 | JGI24705J35276_12232119 | 3300002504 | Bacteria | 4194 |
| 81 | JGI24705J35276_12237010 | 3300002504 | Bacteria | 9559 |
| 82 | Ga0068305_10004729 | 3300005083 | Bacteria | 14351 |
| 83 | Ga0123357_10002874 | 3300009784 | Bacteria | 19418 |
| 84 | Ga0466735_078531 | 3300042624 | Bacteria | 2151 |
| 85 | Ga0466704_061148 | 3300042643 | Bacteria | 3671 |
| 86 | Ga0466704_505644 | 3300042643 | Bacteria | 9520 |
| 87 | Ga0466709_004714 | 3300042648 | Bacteria | 1974 |
| 88 | Ga0466727_170756 | 3300042655 | Bacteria | 3452 |
| 89 | Ga0466707_286883 | 3300042601 | Bacteria | 4422 |
| 90 | Ga0466713_044001 | 3300042602 | Bacteria | 42258 |
| 91 | Ga0466713_047392 | 3300042602 | Bacteria | 6997 |
| 92 | Ga0466722_148621 | 3300042609 | Bacteria | 3851 |
| 93 | Ga0466705_007870 | 3300042612 | Bacteria | 28662 |
| 94 | Ga0466728_030059 | 3300042620 | Bacteria | 8376 |
| 95 | Ga0123353_10271365 | 3300010167 | Bacteria | 2613 |
| 96 | Ga0466690_369127 | 3300042590 | Bacteria | 12418 |
| 97 | Ga0466691_093033 | 3300042593 | Bacteria | 12147 |
| 98 | JGI24705J35276_12238730 | 3300002504 | Bacteria | 46742 |
| 99 | Ga0068305_10083512 | 3300005083 | Bacteria | 17021 |
| 100 | Ga0466703_089004 | 3300042636 | Bacteria | 22238 |
| 101 | Ga0466703_265231 | 3300042636 | Bacteria | 35509 |
| 102 | Ga0466704_222354 | 3300042643 | Bacteria | 31272 |
| 103 | Ga0466727_345918 | 3300042655 | Bacteria | 4517 |
| 104 | Ga0466727_346347 | 3300042655 | Bacteria | 4837 |
| 105 | Ga0466701_069354 | 3300042598 | Bacteria | 4008 |
| 106 | Ga0466707_009633 | 3300042601 | Bacteria | 35190 |
| 107 | Ga0466707_273436 | 3300042601 | Bacteria | 3837 |
| 108 | Ga0466722_229738 | 3300042609 | Bacteria | 42096 |
| 109 | Ga0466697_030728 | 3300042611 | Bacteria | 1607 |
| 110 | Ga0466728_019578 | 3300042620 | Bacteria | 68915 |
| 111 | Ga0123357_10010638 | 3300009784 | Bacteria | 11722 |
| 112 | Ga0123353_10049367 | 3300010167 | Bacteria | 6703 |
| 113 | Ga0123354_10137685 | 3300010882 | Unclassified | 3041 |
| 114 | Ga0466696_085038 | 3300042596 | Bacteria | 5055 |
| 115 | Ga0466696_085502 | 3300042596 | Bacteria | 15546 |
| 116 | Ga0466696_328097 | 3300042596 | Bacteria | 7211 |
| 117 | JGI24702J35022_10006559 | 3300002462 | Bacteria | 6724 |
| 118 | JGI24705J35276_12213260 | 3300002504 | Bacteria | 1918 |
| 119 | Ga0123357_10001908 | 3300009784 | Bacteria | 22681 |
| 120 | Ga0466729_212035 | 3300042621 | Bacteria | 9717 |
| 121 | Ga0466703_074379 | 3300042636 | Bacteria | 18711 |
| 122 | Ga0466709_124130 | 3300042648 | Bacteria | 272718 |
| 123 | Ga0466724_33645 | 3300042649 | Bacteria | 6982 |
| 124 | Ga0466708_311886 | 3300042652 | Bacteria | 13167 |
| 125 | Ga0466701_098523 | 3300042598 | Bacteria | 77309 |
| 126 | Ga0466706_075896 | 3300042599 | Bacteria | 2246 |
| 127 | Ga0466707_006434 | 3300042601 | Bacteria | 3235 |
| 128 | Ga0466713_050140 | 3300042602 | Bacteria | 15810 |
| 129 | Ga0466716_395857 | 3300042605 | Bacteria | 3453 |
| 130 | Ga0466715_081257 | 3300042616 | Bacteria | 32787 |
| 131 | Ga0466726_087706 | 3300042619 | Bacteria | 2953 |
| 132 | Ga0123354_10003756 | 3300010882 | Bacteria | 21142 |
| 133 | Ga0123354_10018723 | 3300010882 | Bacteria | 10867 |
| 134 | Ga0466735_218098 | 3300042624 | Bacteria | 3823 |
| 135 | Ga0466704_110891 | 3300042643 | Bacteria | 7069 |
| 136 | Ga0466704_119159 | 3300042643 | Bacteria | 27307 |
| 137 | Ga0466700_391349 | 3300042600 | Bacteria | 41227 |
| 138 | Ga0466707_105571 | 3300042601 | Bacteria | 9962 |
| 139 | Ga0466716_238887 | 3300042605 | Bacteria | 28802 |
| 140 | Ga0466716_312373 | 3300042605 | Bacteria | 8151 |
| 141 | Ga0466716_424402 | 3300042605 | Bacteria | 27848 |
| 142 | Ga0466719_111332 | 3300042606 | Bacteria | 20001 |
| 143 | Ga0466722_100835 | 3300042609 | Bacteria | 10702 |
| 144 | Ga0466711_169251 | 3300042615 | Bacteria | 20452 |
| 145 | Ga0466715_100049 | 3300042616 | Bacteria | 24536 |
| 146 | Ga0466715_372014 | 3300042616 | Bacteria | 24656 |
| 147 | Ga0466728_075600 | 3300042620 | Bacteria | 18453 |
| 148 | Ga0123357_10021926 | 3300009784 | Bacteria | 8556 |
| 149 | Ga0123356_10239034 | 3300010049 | Bacteria | 1886 |
| 150 | Ga0123353_10379601 | 3300010167 | Bacteria | 2114 |
| 151 | Ga0466690_056201 | 3300042590 | Bacteria | 31912 |
| 152 | Ga0466692_012061 | 3300042591 | Bacteria | 54313 |
| 153 | Ga0466692_165865 | 3300042591 | Bacteria | 23835 |
| 154 | Ga0466696_329822 | 3300042596 | Bacteria | 19237 |
| 155 | Ga0466701_010863 | 3300042598 | Bacteria | 2846 |
| 156 | Ga0123357_10001478 | 3300009784 | Bacteria | 24976 |
| 157 | Ga0466731_008971 | 3300042622 | Bacteria | 33045 |
| 158 | Ga0466703_146643 | 3300042636 | Bacteria | 8922 |
| 159 | Ga0466703_190077 | 3300042636 | Bacteria | 16721 |
| 160 | Ga0466704_097655 | 3300042643 | Bacteria | 5923 |
| 161 | Ga0466713_007402 | 3300042602 | Bacteria | 4618 |
| 162 | Ga0466716_248815 | 3300042605 | Bacteria | 15950 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01098 | FTSW_RODA_SPOVE | Cell cycle protein | 15 | 199 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.