Protein Family IF13345
Metagenome
Isolate
238
Members
155
Samples
152
Scaffolds
326.41
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|3003869270|3003871871|
- Length
- 346 aa
- Sequence
- MNTPNPVSQGSTVSNDNAASADRFRYGFLKGNPQLTKNGELKHLLTIEGLPRAIVNHILDTAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLLDTINNLSAMHADMFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKKDFTNLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVRVFHNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAKPDAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNND
Sample Types
Isolate
36.1%
Metagenome
63.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
40.7%
Termitidae
14.0%
Unclassified
13.3%
Kalotermitidae
8.7%
Formicidae
7.3%
Culicidae
4.7%
Rhinotermitidae
2.0%
Elmidae
2.0%
Termopsidae
2.0%
Passalidae
1.3%
Largidae
1.3%
Alydidae
1.3%
Hodotermitidae
0.7%
Berytidae
0.7%
Taxonomy
Archaea
0
Bacteria
203
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 2 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 3 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 6 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 7 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 8 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 17 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 18 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 19 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 20 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 21 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 22 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 23 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 32 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 33 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 34 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 35 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 36 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 37 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 38 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 39 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 40 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 41 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 42 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 43 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 44 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 45 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 46 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 47 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 48 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 55 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 56 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 57 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 58 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 59 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 60 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 61 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 65 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 66 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 67 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 68 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 69 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 70 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 71 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 72 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 73 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 74 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 75 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 76 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 77 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 78 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 79 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 80 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 81 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 82 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 83 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 84 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 85 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 86 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 87 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 88 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 89 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 90 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 91 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 92 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 93 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 94 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 95 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 96 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 97 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 98 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 99 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 100 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 101 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 102 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 103 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 104 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 105 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 106 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 107 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 108 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 109 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 110 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 111 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 112 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 113 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 114 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 115 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 116 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 117 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 118 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 119 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 120 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 121 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 122 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 123 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 124 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 125 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 126 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 127 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 128 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 129 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 130 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 131 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 132 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 133 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 134 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 135 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 136 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 137 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 138 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 139 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 140 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 141 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 142 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 143 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 144 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 145 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 146 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 147 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 148 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 149 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 150 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 151 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 152 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 153 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 154 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 155 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_255931 | 3300042621 | Unclassified | 5291 |
| 2 | Ga0466734_080560 | 3300042623 | Bacteria | 12255 |
| 3 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 4 | Ga0466704_379031 | 3300042643 | Bacteria | 20777 |
| 5 | Ga0466708_041784 | 3300042652 | Bacteria | 2770 |
| 6 | Ga0466710_300250 | 3300042613 | Bacteria | 5292 |
| 7 | Ga0123356_10070693 | 3300010049 | Bacteria | 3274 |
| 8 | Ga0466707_038306 | 3300042601 | Bacteria | 2257 |
| 9 | Ga0466719_194276 | 3300042606 | Bacteria | 7401 |
| 10 | Ga0102737_1002910 | 3300007142 | Bacteria | 4079 |
| 11 | Ga0466657_272357 | 3300042582 | Bacteria | 12531 |
| 12 | Ga0466691_014028 | 3300042593 | Bacteria | 3544 |
| 13 | Ga0466691_018600 | 3300042593 | Bacteria | 11518 |
| 14 | Ga0466701_011515 | 3300042598 | Bacteria | 3499 |
| 15 | Ga0466710_249192 | 3300042613 | Bacteria | 63183 |
| 16 | Ga0466726_187307 | 3300042619 | Bacteria | 2871 |
| 17 | Ga0466726_342022 | 3300042619 | Bacteria | 4457 |
| 18 | Ga0466729_016426 | 3300042621 | Bacteria | 23520 |
| 19 | Ga0466706_247837 | 3300042599 | Bacteria | 4599 |
| 20 | Ga0466717_078975 | 3300042604 | Bacteria | 2439 |
| 21 | Ga0466719_554859 | 3300042606 | Unclassified | 6103 |
| 22 | Ga0466722_117111 | 3300042609 | Bacteria | 3001 |
| 23 | Ga0102739_1000434 | 3300007095 | Unclassified | 8712 |
| 24 | Ga0102734_1005948 | 3300007129 | Bacteria | 4703 |
| 25 | Ga0103264_1000955 | 3300007188 | Bacteria | 12944 |
| 26 | Ga0466656_164154 | 3300042550 | Unclassified | 1756 |
| 27 | Ga0466690_210430 | 3300042590 | Bacteria | 39724 |
| 28 | Ga0466690_225501 | 3300042590 | Bacteria | 4379 |
| 29 | Ga0466691_111608 | 3300042593 | Bacteria | 5125 |
| 30 | Ga0466704_244902 | 3300042643 | Bacteria | 52327 |
| 31 | Ga0466708_132833 | 3300042652 | Bacteria | 2621 |
| 32 | Ga0466708_299199 | 3300042652 | Bacteria | 10605 |
| 33 | Ga0160471_101107 | 3300012812 | Unclassified | 5772 |
| 34 | Ga0466701_035415 | 3300042598 | Bacteria | 2561 |
| 35 | Ga0466707_092310 | 3300042601 | Bacteria | 3816 |
| 36 | Ga0466713_026884 | 3300042602 | Bacteria | 64226 |
| 37 | Ga0466719_225670 | 3300042606 | Bacteria | 3204 |
| 38 | JGI24702J35022_10001087 | 3300002462 | Bacteria | 16922 |
| 39 | CVPL005W_1000217 | 3300002934 | Unclassified | 25953 |
| 40 | Ga0103265_1005621 | 3300007068 | Unclassified | 2663 |
| 41 | Ga0160459_100028 | 3300012831 | Bacteria | 313883 |
| 42 | Ga0160472_101527 | 3300012839 | Unclassified | 6604 |
| 43 | Ga0466657_391823 | 3300042582 | Unclassified | 3022 |
| 44 | Ga0466690_195904 | 3300042590 | Bacteria | 27777 |
| 45 | Ga0466692_063852 | 3300042591 | Bacteria | 48253 |
| 46 | Ga0466695_074162 | 3300042595 | Bacteria | 5435 |
| 47 | Ga0466697_131734 | 3300042611 | Bacteria | 1986 |
| 48 | Ga0466705_320502 | 3300042612 | Bacteria | 5188 |
| 49 | Ga0466734_160594 | 3300042623 | Unclassified | 1695 |
| 50 | Ga0466703_114672 | 3300042636 | Bacteria | 2291 |
| 51 | Ga0466709_408176 | 3300042648 | Bacteria | 55853 |
| 52 | Ga0466725_195637 | 3300042654 | Bacteria | 58825 |
| 53 | Ga0466710_018744 | 3300042613 | Unclassified | 20032 |
| 54 | Ga0466711_096497 | 3300042615 | Bacteria | 3189 |
| 55 | Ga0466711_118576 | 3300042615 | Bacteria | 5313 |
| 56 | Ga0466715_526460 | 3300042616 | Bacteria | 14481 |
| 57 | Ga0466715_611400 | 3300042616 | Bacteria | 26472 |
| 58 | Ga0123353_10000514 | 3300010167 | Bacteria | 47868 |
| 59 | Ga0466717_093701 | 3300042604 | Bacteria | 1595 |
| 60 | Ga0068305_10007128 | 3300005083 | Bacteria | 16535 |
| 61 | Ga0102735_1009453 | 3300007080 | Bacteria | 2268 |
| 62 | Ga0103268_1000064 | 3300007192 | Unclassified | 32442 |
| 63 | Ga0160470_102894 | 3300012813 | Unclassified | 3002 |
| 64 | Ga0160441_102420 | 3300012825 | Unclassified | 3807 |
| 65 | Ga0466657_007904 | 3300042582 | Bacteria | 2818 |
| 66 | Ga0466657_385949 | 3300042582 | Bacteria | 41593 |
| 67 | Ga0466696_014912 | 3300042596 | Bacteria | 2600 |
| 68 | Ga0466701_013932 | 3300042598 | Bacteria | 93883 |
| 69 | Ga0466729_280356 | 3300042621 | Unclassified | 2800 |
| 70 | Ga0466730_009690 | 3300042625 | Bacteria | 11098 |
| 71 | Ga0466703_308157 | 3300042636 | Bacteria | 9667 |
| 72 | Ga0466704_450010 | 3300042643 | Bacteria | 23573 |
| 73 | Ga0466709_256489 | 3300042648 | Bacteria | 2264 |
| 74 | Ga0466725_004635 | 3300042654 | Bacteria | 11346 |
| 75 | Ga0466710_196714 | 3300042613 | Unclassified | 1469 |
| 76 | Ga0466710_328986 | 3300042613 | Bacteria | 1099 |
| 77 | Ga0466712_167209 | 3300042614 | Bacteria | 9813 |
| 78 | Ga0466715_593216 | 3300042616 | Unclassified | 4144 |
| 79 | Ga0466715_626653 | 3300042616 | Unclassified | 3341 |
| 80 | Ga0466723_292835 | 3300042618 | Bacteria | 6797 |
| 81 | Ga0123357_10009839 | 3300009784 | Bacteria | 12100 |
| 82 | Ga0123354_10000604 | 3300010882 | Bacteria | 37391 |
| 83 | Ga0466707_031659 | 3300042601 | Bacteria | 2542 |
| 84 | Ga0068302_10059709 | 3300005071 | Unclassified | 10444 |
| 85 | Ga0072941_1224648 | 3300005201 | Bacteria | 3527 |
| 86 | Ga0103267_1000528 | 3300007190 | Bacteria | 16179 |
| 87 | Ga0160472_100904 | 3300012839 | Unclassified | 11568 |
| 88 | Ga0160436_1004467 | 3300012861 | Unclassified | 3330 |
| 89 | Ga0466657_188649 | 3300042582 | Bacteria | 43962 |
| 90 | Ga0466692_009630 | 3300042591 | Bacteria | 10501 |
| 91 | Ga0466695_132386 | 3300042595 | Bacteria | 4007 |
| 92 | Ga0466696_084162 | 3300042596 | Bacteria | 8505 |
| 93 | Ga0466732_399172 | 3300042656 | Unclassified | 2347 |
| 94 | Ga0466703_034196 | 3300042636 | Bacteria | 11900 |
| 95 | Ga0466725_104679 | 3300042654 | Bacteria | 48730 |
| 96 | Ga0466723_164146 | 3300042618 | Bacteria | 43837 |
| 97 | Ga0160454_100171 | 3300012798 | Bacteria | 73904 |
| 98 | Ga0466706_166069 | 3300042599 | Bacteria | 5284 |
| 99 | Ga0466707_146269 | 3300042601 | Bacteria | 18972 |
| 100 | Ga0466707_147961 | 3300042601 | Bacteria | 3827 |
| 101 | Ga0466713_049727 | 3300042602 | Bacteria | 4414 |
| 102 | Ga0466722_021019 | 3300042609 | Bacteria | 4816 |
| 103 | JGI24705J35276_12221101 | 3300002504 | Unclassified | 2314 |
| 104 | Ga0123357_10000043 | 3300009784 | Bacteria | 100872 |
| 105 | Ga0160472_100330 | 3300012839 | Bacteria | 45272 |
| 106 | Ga0466657_283260 | 3300042582 | Bacteria | 2591 |
| 107 | Ga0466690_434205 | 3300042590 | Bacteria | 3306 |
| 108 | Ga0466730_078619 | 3300042625 | Unclassified | 1654 |
| 109 | Ga0466709_039309 | 3300042648 | Unclassified | 13773 |
| 110 | Ga0466708_466618 | 3300042652 | Bacteria | 13934 |
| 111 | Ga0466715_036258 | 3300042616 | Bacteria | 28515 |
| 112 | Ga0466715_604968 | 3300042616 | Unclassified | 1860 |
| 113 | Ga0466718_067336 | 3300042617 | Unclassified | 4637 |
| 114 | Ga0466723_234806 | 3300042618 | Bacteria | 26410 |
| 115 | Ga0466729_114729 | 3300042621 | Unclassified | 2900 |
| 116 | Ga0160464_100185 | 3300012805 | Bacteria | 63812 |
| 117 | Ga0466707_216115 | 3300042601 | Unclassified | 8927 |
| 118 | Ga0466719_486009 | 3300042606 | Bacteria | 3770 |
| 119 | Ga0466722_224459 | 3300042609 | Bacteria | 2233 |
| 120 | IMNBGM34_c000639 | 3300000036 | Bacteria | 8617 |
| 121 | Ga0102736_1001838 | 3300007052 | Bacteria | 8272 |
| 122 | Ga0160446_101278 | 3300012835 | Bacteria | 5685 |
| 123 | Ga0160447_109722 | 3300012849 | Unclassified | 2175 |
| 124 | Ga0466657_332174 | 3300042582 | Unclassified | 7606 |
| 125 | Ga0466692_108873 | 3300042591 | Bacteria | 36462 |
| 126 | Ga0466705_059463 | 3300042612 | Bacteria | 40059 |
| 127 | Ga0466705_171973 | 3300042612 | Bacteria | 113809 |
| 128 | Ga0466733_152755 | 3300042659 | Bacteria | 25204 |
| 129 | Ga0466734_034170 | 3300042623 | Bacteria | 2648 |
| 130 | Ga0466703_011291 | 3300042636 | Bacteria | 72818 |
| 131 | Ga0466708_035964 | 3300042652 | Bacteria | 7439 |
| 132 | Ga0466725_104284 | 3300042654 | Bacteria | 17657 |
| 133 | Ga0466725_152336 | 3300042654 | Bacteria | 15323 |
| 134 | Ga0466727_065602 | 3300042655 | Bacteria | 48878 |
| 135 | Ga0466727_180665 | 3300042655 | Bacteria | 3967 |
| 136 | Ga0466710_187806 | 3300042613 | Bacteria | 2652 |
| 137 | Ga0466711_384001 | 3300042615 | Bacteria | 14197 |
| 138 | Ga0466715_243616 | 3300042616 | Bacteria | 2883 |
| 139 | Ga0466726_091262 | 3300042619 | Bacteria | 5121 |
| 140 | Ga0466726_152540 | 3300042619 | Bacteria | 13721 |
| 141 | Ga0466728_460092 | 3300042620 | Bacteria | 8068 |
| 142 | Ga0466719_235195 | 3300042606 | Bacteria | 18905 |
| 143 | Ga0466722_222897 | 3300042609 | Bacteria | 5328 |
| 144 | IMNBL1DRAFT_c0004656 | 3300000062 | Unclassified | 8140 |
| 145 | JGI24702J35022_10005842 | 3300002462 | Unclassified | 7157 |
| 146 | JGI24702J35022_10123387 | 3300002462 | Unclassified | 1432 |
| 147 | Ga0103266_1000436 | 3300007067 | Bacteria | 8922 |
| 148 | Ga0103264_1004143 | 3300007188 | Bacteria | 6783 |
| 149 | Ga0160452_100131 | 3300012834 | Bacteria | 91886 |
| 150 | Ga0415639_146308 | 3300038395 | Bacteria | 5357 |
| 151 | Ga0466691_208577 | 3300042593 | Bacteria | 3059 |
| 152 | Ga0466696_024793 | 3300042596 | Bacteria | 7020 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.