Protein Family IF13341
Metagenome
Isolate
136
Members
87
Samples
101
Scaffolds
227.62
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|3003869270|3003871559|
- Length
- 257 aa
- Sequence
- MPAQSKSEPPSVADRQTHQPQEHSMIDIYSWATPNGHKIHIMLEETGLDYKAHPINIGAGDQFTPEFLAISPNNKIPAIVDSDGPKNPDGKPFSLFESGAILIYLAEKTGKFLPNDPAARYETLQWLMFQMGGIGPMLGQTHHFRVYAPQPIEYAINRYTNETKRLYGVMDTKLGKTRYLAGDDYTIADIATFPWTRSWQNQGLQIDDFPNVKRWHEEIAARPAVQRGVEVLASARVPLMDEKAKEILFGATQYAKH
Sample Types
Isolate
25.7%
Metagenome
74.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
15.9%
Coreidae
15.9%
Formicidae
12.2%
Unclassified
8.5%
Kalotermitidae
8.5%
Elmidae
7.3%
Culicidae
7.3%
Armadillidiidae
7.3%
Curculionidae
3.7%
Termopsidae
3.7%
Largidae
2.4%
Rhinotermitidae
2.4%
Passalidae
1.2%
Tenebrionidae
1.2%
Berytidae
1.2%
Alydidae
1.2%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 2 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 3 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 6 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 7 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 8 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 9 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 10 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 11 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 12 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 13 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 14 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 22 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 23 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 24 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 25 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 26 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 31 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 32 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 33 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 34 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 35 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 36 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 37 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 38 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 41 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 42 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 43 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 44 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 45 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 46 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 47 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 48 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 49 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 52 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 53 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 58 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 59 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 60 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 61 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 62 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 63 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 66 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 67 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 68 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 71 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 75 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 76 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 77 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 78 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 79 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 82 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 86 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 87 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_008650 | 3300042659 | Bacteria | 3561 |
| 2 | Ga0530661_027707 | 3300056564 | Bacteria | 1628 |
| 3 | Ga0466701_051965 | 3300042598 | Bacteria | 80920 |
| 4 | Ga0466719_182434 | 3300042606 | Bacteria | 1417 |
| 5 | Ga0123355_10481310 | 3300009826 | Bacteria | 1544 |
| 6 | Ga0123354_10059159 | 3300010882 | Bacteria | 5686 |
| 7 | Ga0160466_102803 | 3300012809 | Unclassified | 3186 |
| 8 | Ga0466729_297861 | 3300042621 | Bacteria | 1628 |
| 9 | Ga0466734_026716 | 3300042623 | Bacteria | 2915 |
| 10 | Ga0466704_456916 | 3300042643 | Bacteria | 1737 |
| 11 | Ga0160470_100689 | 3300012813 | Unclassified | 11024 |
| 12 | Ga0160472_100537 | 3300012839 | Bacteria | 23940 |
| 13 | Ga0160447_104293 | 3300012849 | Bacteria | 4261 |
| 14 | Ga0466657_146724 | 3300042582 | Bacteria | 2567 |
| 15 | Ga0466691_021243 | 3300042593 | Bacteria | 12453 |
| 16 | CVPL010W_10002519 | 3300002931 | Bacteria | 21462 |
| 17 | CVPL010W_10004311 | 3300002931 | Bacteria | 15881 |
| 18 | Ga0103264_1000265 | 3300007188 | Bacteria | 35691 |
| 19 | Ga0103264_1001617 | 3300007188 | Bacteria | 9992 |
| 20 | Ga0123355_10420724 | 3300009826 | Bacteria | 1708 |
| 21 | Ga0466735_085279 | 3300042624 | Bacteria | 1289 |
| 22 | Ga0466725_140528 | 3300042654 | Bacteria | 25711 |
| 23 | Ga0466727_287819 | 3300042655 | Bacteria | 1446 |
| 24 | Ga0160472_103243 | 3300012839 | Bacteria | 3301 |
| 25 | Ga0160447_102524 | 3300012849 | Bacteria | 6356 |
| 26 | Ga0160447_103154 | 3300012849 | Bacteria | 5420 |
| 27 | JGI24705J35276_12235653 | 3300002504 | Bacteria | 6781 |
| 28 | JGI24705J35276_12236691 | 3300002504 | Bacteria | 8642 |
| 29 | Ga0102734_1000269 | 3300007129 | Bacteria | 18026 |
| 30 | Ga0103264_1000081 | 3300007188 | Bacteria | 56731 |
| 31 | Ga0466719_139280 | 3300042606 | Unclassified | 1740 |
| 32 | Ga0160470_100117 | 3300012813 | Bacteria | 84916 |
| 33 | Ga0466709_048938 | 3300042648 | Bacteria | 1395 |
| 34 | Ga0466709_064991 | 3300042648 | Bacteria | 3594 |
| 35 | Ga0160444_100079 | 3300012841 | Bacteria | 129479 |
| 36 | Ga0160443_103679 | 3300012848 | Unclassified | 2568 |
| 37 | Ga0160457_1005915 | 3300012858 | Bacteria | 1835 |
| 38 | Ga0466692_075681 | 3300042591 | Bacteria | 28830 |
| 39 | Ga0466696_219364 | 3300042596 | Unclassified | 3449 |
| 40 | Ga0103264_1000016 | 3300007188 | Bacteria | 116870 |
| 41 | Ga0103264_1001603 | 3300007188 | Bacteria | 21632 |
| 42 | Ga0466723_276045 | 3300042618 | Bacteria | 9835 |
| 43 | Ga0466701_046521 | 3300042598 | Bacteria | 40345 |
| 44 | Ga0466707_072746 | 3300042601 | Unclassified | 1211 |
| 45 | Ga0123354_10087506 | 3300010882 | Bacteria | 4343 |
| 46 | Ga0466734_105593 | 3300042623 | Bacteria | 1009 |
| 47 | Ga0160472_106483 | 3300012839 | Bacteria | 1736 |
| 48 | Ga0160430_101069 | 3300012852 | Bacteria | 11339 |
| 49 | Ga0160457_1011394 | 3300012858 | Bacteria | 1259 |
| 50 | Ga0466696_033280 | 3300042596 | Bacteria | 1659 |
| 51 | CVPL010L_1001124 | 3300002932 | Unclassified | 4226 |
| 52 | CVPL005W_1000364 | 3300002934 | Unclassified | 19260 |
| 53 | Ga0102734_1000966 | 3300007129 | Bacteria | 11233 |
| 54 | Ga0102737_1009163 | 3300007142 | Bacteria | 1713 |
| 55 | Ga0103264_1000030 | 3300007188 | Bacteria | 85624 |
| 56 | Ga0103268_1000456 | 3300007192 | Bacteria | 12567 |
| 57 | Ga0466710_026533 | 3300042613 | Bacteria | 1215 |
| 58 | Ga0466734_038914 | 3300042623 | Bacteria | 5173 |
| 59 | Ga0466734_085670 | 3300042623 | Bacteria | 1287 |
| 60 | Ga0466734_137214 | 3300042623 | Bacteria | 1097 |
| 61 | Ga0466730_041424 | 3300042625 | Bacteria | 12770 |
| 62 | Ga0466704_328271 | 3300042643 | Bacteria | 2603 |
| 63 | Ga0160440_100003 | 3300012815 | Bacteria | 688892 |
| 64 | Ga0160441_104429 | 3300012825 | Bacteria | 2215 |
| 65 | Ga0160455_105148 | 3300012837 | Bacteria | 1463 |
| 66 | Ga0466656_299150 | 3300042550 | Bacteria | 1434 |
| 67 | CVPL010W_10000171 | 3300002931 | Bacteria | 55711 |
| 68 | Ga0466726_078031 | 3300042619 | Bacteria | 1819 |
| 69 | Ga0466697_185867 | 3300042611 | Bacteria | 1335 |
| 70 | Ga0466716_407378 | 3300042605 | Bacteria | 1965 |
| 71 | Ga0466729_296660 | 3300042621 | Bacteria | 5238 |
| 72 | Ga0466734_056948 | 3300042623 | Bacteria | 1720 |
| 73 | Ga0466725_244103 | 3300042654 | Bacteria | 1213 |
| 74 | Ga0160433_108550 | 3300012846 | Unclassified | 1369 |
| 75 | Ga0466657_029510 | 3300042582 | Bacteria | 3200 |
| 76 | FGTW_contig28607 | 2065487013 | Bacteria | 13353 |
| 77 | JGI24705J35276_12238602 | 3300002504 | Bacteria | 28588 |
| 78 | Ga0466719_240553 | 3300042606 | Bacteria | 1293 |
| 79 | Ga0466704_072474 | 3300042643 | Bacteria | 5088 |
| 80 | Ga0466725_298763 | 3300042654 | Bacteria | 2442 |
| 81 | Ga0160467_100103 | 3300012829 | Bacteria | 123786 |
| 82 | Ga0160455_108652 | 3300012837 | Bacteria | 958 |
| 83 | IMNBGM34_c000015 | 3300000036 | Bacteria | 47738 |
| 84 | JGI24705J35276_12233140 | 3300002504 | Bacteria | 4675 |
| 85 | Ga0103266_1000126 | 3300007067 | Bacteria | 25662 |
| 86 | Ga0102740_1008308 | 3300007140 | Bacteria | 1720 |
| 87 | Ga0102737_1000278 | 3300007142 | Bacteria | 17271 |
| 88 | Ga0466707_286123 | 3300042601 | Bacteria | 3290 |
| 89 | Ga0123357_10281911 | 3300009784 | Bacteria | 1715 |
| 90 | Ga0123357_10476588 | 3300009784 | Bacteria | 1058 |
| 91 | Ga0466704_162620 | 3300042643 | Bacteria | 4449 |
| 92 | Ga0466725_114546 | 3300042654 | Bacteria | 16379 |
| 93 | Ga0160458_104698 | 3300012832 | Unclassified | 1651 |
| 94 | Ga0466657_076463 | 3300042582 | Bacteria | 5676 |
| 95 | Meta3P_1010369 | 3300002464 | Bacteria | 3428 |
| 96 | JGI24705J35276_12235795 | 3300002504 | Bacteria | 6991 |
| 97 | CVPL010L_1004715 | 3300002932 | Bacteria | 1437 |
| 98 | Ga0103264_1000272 | 3300007188 | Bacteria | 28358 |
| 99 | Ga0103267_1000195 | 3300007190 | Bacteria | 41160 |
| 100 | Ga0123357_10000063 | 3300009784 | Bacteria | 85298 |
| 101 | Ga0466710_421279 | 3300042613 | Bacteria | 6780 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00043 | GST_C | Glutathione S-transferase, C-terminal domain | 161 | 223 | 0.95 |
| PF02798 | GST_N | Glutathione S-transferase, N-terminal domain | 28 | 107 | 0.93 |
| PF13410 | GST_C_2 | Glutathione S-transferase, C-terminal domain | 155 | 217 | 0.91 |
| PF13409 | GST_N_2 | Glutathione S-transferase, N-terminal domain | 34 | 107 | 0.89 |
| PF14497 | GST_C_3 | Glutathione S-transferase, C-terminal domain | 159 | 226 | 0.88 |
| PF13417 | GST_N_3 | Glutathione S-transferase, N-terminal domain | 34 | 109 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.