Protein Family IF13229
Metagenome
Isolate
202
Members
183
Samples
59
Scaffolds
214.62
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2997878596|2997880750|
- Length
- 235 aa
- Sequence
- MPEVVKPEAVKPDVSKPDTPQPCDVVVLLSGTGGNLQAMIDSFQDGSSPARIRAVISNRADAYGLERANNAGIETRVLDHKAYEGREAFDTALIELIDSFAPKLVVLAGFMRILTPAFVRHYHGRLLNIHPSLLPLYKGLHTHQRVLEAGDAQHGCSVHFVTEELDGGPLVVQAVISVELHDTPTTLARRVHTQEHLIYPLAIRWFAEGRLALSEHGASLNGQLLGPCGHLLPAT
Sample Types
Isolate
70.8%
Metagenome
29.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
42.4%
Drosophilidae
12.7%
Elmidae
7.9%
Curculionidae
6.7%
Culicidae
4.2%
Armadillidiidae
3.0%
Termitidae
3.0%
Formicidae
2.4%
Talitridae
1.8%
Palinuridae
1.8%
Tenebrionidae
1.8%
Pteromalidae
1.8%
Cerambycidae
1.2%
Calliphoridae
1.2%
Aphididae
1.2%
Apidae
1.2%
Penaeidae
0.6%
Reduviidae
0.6%
Ixodidae
0.6%
Siricidae
0.6%
Trigoniulidae
0.6%
Nephropidae
0.6%
Lysianassidae
0.6%
Majidae
0.6%
Artemiidae
0.6%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 2 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 3 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 4 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 5 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 6 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 7 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 8 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 9 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 10 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 11 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 12 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 13 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 14 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 15 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 16 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 17 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 18 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 19 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 20 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 21 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 22 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 23 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 24 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 25 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 26 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 27 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 28 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 29 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 30 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 31 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 32 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 33 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 34 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 35 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 36 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 37 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 38 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 39 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 40 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 41 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 42 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 43 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 44 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 45 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 46 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 47 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 48 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 49 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 50 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 51 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 52 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 53 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 54 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 55 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 56 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 57 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 58 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 59 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 60 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 61 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 62 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 63 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 64 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 65 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 66 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 67 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 68 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 69 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 70 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 71 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 72 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 73 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 74 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 75 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 76 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 77 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 78 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 79 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 80 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 81 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 82 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 83 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 84 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 85 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 86 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 87 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 88 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 89 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 90 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 91 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 92 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 93 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 94 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 95 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 96 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 97 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 98 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 99 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 100 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 101 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 102 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 103 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 104 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 105 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 106 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 107 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 108 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 109 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 110 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 111 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 112 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 113 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 114 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 115 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 116 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 117 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 118 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 119 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 120 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 121 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 122 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 123 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 124 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 125 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 126 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 127 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 128 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 129 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 130 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 131 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 132 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 133 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 134 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 135 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 136 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 137 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 138 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 139 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 140 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 141 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 142 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 143 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 144 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 145 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 146 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 147 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 148 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 149 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 150 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 151 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 152 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 153 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 154 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 155 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 156 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 157 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 158 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 159 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 160 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 161 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 162 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 163 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 164 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 165 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 166 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 167 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 168 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 169 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 170 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 171 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 172 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 173 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 174 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 175 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 176 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 177 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 178 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 179 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 180 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 181 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 182 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 183 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0288 | 3300056814 | Bacteria | 106393 |
| 2 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 3 | Ga0160470_100651 | 3300012813 | Unclassified | 11687 |
| 4 | Ga0160441_100777 | 3300012825 | Bacteria | 16693 |
| 5 | Meta3P_1000465 | 3300002464 | Bacteria | 26510 |
| 6 | CVPL010L_1003199 | 3300002932 | Unclassified | 1899 |
| 7 | Ga0103264_1000467 | 3300007188 | Bacteria | 42232 |
| 8 | Ga0127656_100320 | 3300009453 | Bacteria | 24091 |
| 9 | Ga0466701_052319 | 3300042598 | Bacteria | 107579 |
| 10 | Ga0123353_10057488 | 3300010167 | Unclassified | 6231 |
| 11 | Ga0160465_100542 | 3300012803 | Unclassified | 16822 |
| 12 | Ga0160447_100391 | 3300012849 | Bacteria | 21857 |
| 13 | DPO_contig08759 | 2032320009 | Unclassified | 12927 |
| 14 | DPOL_contig18765 | 2035918003 | Bacteria | 16169 |
| 15 | Ga0074188_1000378 | 3300005318 | Bacteria | 15132 |
| 16 | Ga0104049_1137602 | 3300007103 | Bacteria | 1010 |
| 17 | Ga0105005_1026430 | 3300007505 | Bacteria | 5534 |
| 18 | Ga0127645_109031 | 3300009461 | Bacteria | 20576 |
| 19 | Ga0466730_015129 | 3300042625 | Bacteria | 3317 |
| 20 | Ga0466730_020598 | 3300042625 | Unclassified | 1913 |
| 21 | Ga0466724_64900 | 3300042649 | Bacteria | 3217 |
| 22 | Ga0466701_102488 | 3300042598 | Bacteria | 117881 |
| 23 | Ga0466717_020321 | 3300042604 | Bacteria | 6485 |
| 24 | Ga0160456_100373 | 3300012820 | Bacteria | 16044 |
| 25 | DPO_contig09256 | 2032320009 | Bacteria | 18326 |
| 26 | Ga0104040_1155727 | 3300007149 | Bacteria | 1010 |
| 27 | Ga0105005_1039398 | 3300007505 | Bacteria | 23432 |
| 28 | Ga0466724_11674 | 3300042649 | Unclassified | 17516 |
| 29 | Ga0466724_27463 | 3300042649 | Unclassified | 8013 |
| 30 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 31 | SPBB_contig11507 | 2044078006 | Bacteria | 117601 |
| 32 | Ga0104041_1002457 | 3300007106 | Bacteria | 12585 |
| 33 | Ga0127524_173303 | 3300009478 | Bacteria | 1226 |
| 34 | Ga0466730_076174 | 3300042625 | Bacteria | 1325 |
| 35 | Ga0466724_08972 | 3300042649 | Bacteria | 58576 |
| 36 | Ga0466724_30137 | 3300042649 | Bacteria | 6533 |
| 37 | Ga0160454_100247 | 3300012798 | Bacteria | 52886 |
| 38 | Ga0160467_101827 | 3300012829 | Unclassified | 6469 |
| 39 | Ga0160455_106249 | 3300012837 | Bacteria | 1222 |
| 40 | Ga0160435_1001571 | 3300012857 | Unclassified | 5761 |
| 41 | Ga0316159_10004 | 3300030930 | Bacteria | 218282 |
| 42 | FGTW_contig30515 | 2065487013 | Bacteria | 19946 |
| 43 | SWWA_contig31635__length_57763___numreads_3216 | 2100351016 | Bacteria | 57763 |
| 44 | Ga0074302_1142760 | 3300005316 | Unclassified | 1014 |
| 45 | Ga0104041_1117318 | 3300007106 | Unclassified | 1207 |
| 46 | Ga0466730_032652 | 3300042625 | Unclassified | 8295 |
| 47 | Ga0466701_103106 | 3300042598 | Bacteria | 35693 |
| 48 | Meta3P_1004819 | 3300002464 | Unclassified | 8054 |
| 49 | Ga0102734_1001199 | 3300007129 | Bacteria | 6569 |
| 50 | Ga0160433_100119 | 3300012846 | Bacteria | 74337 |
| 51 | DPOL_contig18631 | 2035918003 | Bacteria | 49264 |
| 52 | Ga0160445_100843 | 3300012847 | Bacteria | 11186 |
| 53 | Ga0160448_101750 | 3300012854 | Bacteria | 6936 |
| 54 | Ga0160448_104601 | 3300012854 | Bacteria | 3800 |
| 55 | SPBB_contig08588 | 2044078006 | Unclassified | 1121 |
| 56 | SPBB_contig11550 | 2044078006 | Bacteria | 46395 |
| 57 | Ga0063521_1000075 | 3300003973 | Bacteria | 80955 |
| 58 | Ga0104041_1110790 | 3300007106 | Bacteria | 2381 |
| 59 | Ga0466724_41843 | 3300042649 | Bacteria | 3415 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00551 | Formyl_trans_N | Formyl transferase | 25 | 203 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00551 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.