Protein Family IF13095
Metagenome
Isolate
178
Members
59
Samples
159
Scaffolds
293.64
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2940413413|2940418135|
- Length
- 321 aa
- Sequence
- MLSQTETALGSSRRTGKRTKRQRQPNEISNISNLLINIFFWIYTAICVVPLILVVIVSFSDENSVIQNGYSFFPNKWDISSYEFLLKDYWQIIDAASVSLFVTVVGTILSLIIMAMYAYPISRGDFPHRNFFSFFMFFTMLFNGGLVPWYLVYTRMMHMKDTLWILIMPLLVSAFFVIILRTFFANTIPPALIESAKIDGAPEFRIFVQIILPLSMPVLATVGLFQTLAYWNDWYLSLIFISPEGHVNLQYLMYKTMLNVQFLTASPQAMAALAAQGVEINIPTETVRMAMAVIGIGPIVFVYSFFQKYFIKGLTVGAVKG
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.2%
Kalotermitidae
23.6%
Unclassified
10.9%
Blattidae
5.5%
Rhinotermitidae
5.5%
Armadillidiidae
5.5%
Termopsidae
5.5%
Scarabaeidae
1.8%
Passalidae
1.8%
Culicidae
1.8%
Taxonomy
Archaea
0
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 2 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 3 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 4 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 7 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 8 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 25 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 26 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 27 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 40 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 41 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 54 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 55 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 56 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_109955 | 3300042636 | Bacteria | 19871 |
| 2 | Ga0466704_387520 | 3300042643 | Bacteria | 4122 |
| 3 | Ga0466704_593331 | 3300042643 | Unclassified | 2711 |
| 4 | Ga0466708_091499 | 3300042652 | Bacteria | 5085 |
| 5 | Ga0466719_166858 | 3300042606 | Bacteria | 11243 |
| 6 | Ga0466720_136175 | 3300042607 | Bacteria | 1697 |
| 7 | Ga0123356_10053573 | 3300010049 | Bacteria | 3755 |
| 8 | Ga0123356_10099234 | 3300010049 | Bacteria | 2791 |
| 9 | Ga0123353_10000789 | 3300010167 | Bacteria | 38593 |
| 10 | Ga0123353_10055918 | 3300010167 | Bacteria | 6315 |
| 11 | Ga0123353_10292555 | 3300010167 | Unclassified | 2492 |
| 12 | Ga0123353_10842486 | 3300010167 | Bacteria | 1258 |
| 13 | Ga0160465_103196 | 3300012803 | Bacteria | 3102 |
| 14 | Ga0160466_107634 | 3300012809 | Bacteria | 1262 |
| 15 | Ga0466711_029489 | 3300042615 | Bacteria | 2194 |
| 16 | Ga0466711_196484 | 3300042615 | Bacteria | 4104 |
| 17 | Ga0466715_102913 | 3300042616 | Bacteria | 6763 |
| 18 | Ga0466715_350760 | 3300042616 | Unclassified | 7883 |
| 19 | Ga0160443_100242 | 3300012848 | Bacteria | 58528 |
| 20 | Ga0466656_047684 | 3300042550 | Bacteria | 1113 |
| 21 | Ga0466732_273851 | 3300042656 | Unclassified | 1837 |
| 22 | Ga0466729_211796 | 3300042621 | Bacteria | 4526 |
| 23 | Ga0466703_126633 | 3300042636 | Bacteria | 5179 |
| 24 | Ga0466703_156601 | 3300042636 | Bacteria | 19933 |
| 25 | Ga0466704_263049 | 3300042643 | Unclassified | 2524 |
| 26 | Ga0466704_537782 | 3300042643 | Bacteria | 1369 |
| 27 | Ga0466704_568479 | 3300042643 | Unclassified | 2391 |
| 28 | Ga0466727_346924 | 3300042655 | Bacteria | 1371 |
| 29 | Ga0466707_167566 | 3300042601 | Bacteria | 1942 |
| 30 | Ga0466707_307115 | 3300042601 | Unclassified | 1215 |
| 31 | Ga0466714_039912 | 3300042603 | Bacteria | 1371 |
| 32 | Ga0466719_172465 | 3300042606 | Bacteria | 9621 |
| 33 | Ga0466720_027510 | 3300042607 | Bacteria | 3145 |
| 34 | Ga0466698_262358 | 3300042610 | Bacteria | 1395 |
| 35 | Ga0466698_327018 | 3300042610 | Bacteria | 1518 |
| 36 | Ga0123357_10372054 | 3300009784 | Bacteria | 1338 |
| 37 | Ga0123355_10007252 | 3300009826 | Bacteria | 16577 |
| 38 | Ga0123355_10034037 | 3300009826 | Bacteria | 8275 |
| 39 | Ga0123356_10272033 | 3300010049 | Bacteria | 1784 |
| 40 | Ga0123353_10042497 | 3300010167 | Bacteria | 7188 |
| 41 | Ga0123353_10078804 | 3300010167 | Bacteria | 5296 |
| 42 | Ga0123353_10200240 | 3300010167 | Bacteria | 3142 |
| 43 | Ga0123353_10248970 | 3300010167 | Bacteria | 2754 |
| 44 | Ga0123353_10422803 | 3300010167 | Bacteria | 1974 |
| 45 | Ga0466711_338328 | 3300042615 | Bacteria | 19190 |
| 46 | Ga0466723_043323 | 3300042618 | Bacteria | 23308 |
| 47 | Ga0160445_100857 | 3300012847 | Bacteria | 10993 |
| 48 | Ga0466692_158554 | 3300042591 | Bacteria | 2745 |
| 49 | Ga0466696_457958 | 3300042596 | Bacteria | 4284 |
| 50 | Ga0466705_047390 | 3300042612 | Unclassified | 2860 |
| 51 | Ga0466705_215238 | 3300042612 | Bacteria | 8870 |
| 52 | Ga0466704_053163 | 3300042643 | Unclassified | 3014 |
| 53 | Ga0466704_387104 | 3300042643 | Bacteria | 5382 |
| 54 | Ga0466709_309774 | 3300042648 | Bacteria | 2028 |
| 55 | Ga0466708_214835 | 3300042652 | Bacteria | 9262 |
| 56 | Ga0466727_148876 | 3300042655 | Bacteria | 1060 |
| 57 | Ga0466719_533368 | 3300042606 | Unclassified | 8536 |
| 58 | Ga0466720_226720 | 3300042607 | Bacteria | 5298 |
| 59 | Ga0466721_382500 | 3300042608 | Bacteria | 6128 |
| 60 | Ga0466722_062727 | 3300042609 | Bacteria | 3519 |
| 61 | Ga0123357_10029295 | 3300009784 | Unclassified | 7462 |
| 62 | Ga0123355_10000127 | 3300009826 | Bacteria | 88118 |
| 63 | Ga0123355_10004180 | 3300009826 | Bacteria | 20965 |
| 64 | Ga0123356_10052449 | 3300010049 | Bacteria | 3794 |
| 65 | Ga0123353_10003555 | 3300010167 | Unclassified | 19732 |
| 66 | Ga0123354_10192891 | 3300010882 | Bacteria | 2273 |
| 67 | Ga0466715_533096 | 3300042616 | Bacteria | 5337 |
| 68 | Ga0264413_106082 | 3300024493 | Unclassified | 2896 |
| 69 | Ga0415639_027031 | 3300038395 | Bacteria | 3599 |
| 70 | IMNBL1DRAFT_c0037727 | 3300000062 | Bacteria | 1670 |
| 71 | JGI24702J35022_10108884 | 3300002462 | Bacteria | 1522 |
| 72 | Ga0466705_304914 | 3300042612 | Bacteria | 12323 |
| 73 | Ga0466729_295736 | 3300042621 | Bacteria | 25432 |
| 74 | Ga0466704_159557 | 3300042643 | Unclassified | 6175 |
| 75 | Ga0466701_087397 | 3300042598 | Bacteria | 5670 |
| 76 | Ga0466707_338472 | 3300042601 | Bacteria | 1584 |
| 77 | Ga0123355_10048390 | 3300009826 | Bacteria | 6913 |
| 78 | Ga0123353_10005553 | 3300010167 | Bacteria | 16582 |
| 79 | Ga0123353_10037443 | 3300010167 | Bacteria | 7610 |
| 80 | Ga0466705_416442 | 3300042612 | Unclassified | 7763 |
| 81 | Ga0466711_350659 | 3300042615 | Bacteria | 4421 |
| 82 | Ga0466726_449936 | 3300042619 | Bacteria | 11335 |
| 83 | Ga0160445_102653 | 3300012847 | Bacteria | 3984 |
| 84 | Ga0415639_169817 | 3300038395 | Bacteria | 1908 |
| 85 | Ga0466690_054116 | 3300042590 | Unclassified | 2299 |
| 86 | Ga0466693_322179 | 3300042592 | Bacteria | 1911 |
| 87 | Ga0466691_098258 | 3300042593 | Unclassified | 4125 |
| 88 | Ga0466694_302514 | 3300042594 | Bacteria | 3517 |
| 89 | AustNasuHG_c1000926 | 3300000089 | Bacteria | 10597 |
| 90 | Ga0466702_064739 | 3300042635 | Bacteria | 1987 |
| 91 | Ga0466704_031681 | 3300042643 | Bacteria | 6392 |
| 92 | Ga0466722_137634 | 3300042609 | Bacteria | 3007 |
| 93 | Ga0466698_446499 | 3300042610 | Bacteria | 1385 |
| 94 | Ga0123357_10177110 | 3300009784 | Bacteria | 2503 |
| 95 | Ga0123355_10279533 | 3300009826 | Bacteria | 2307 |
| 96 | Ga0123353_10034931 | 3300010167 | Bacteria | 7857 |
| 97 | Ga0123353_10326657 | 3300010167 | Bacteria | 2325 |
| 98 | Ga0123353_10360156 | 3300010167 | Bacteria | 2186 |
| 99 | Ga0123353_10611531 | 3300010167 | Bacteria | 1554 |
| 100 | Ga0466705_387743 | 3300042612 | Bacteria | 8722 |
| 101 | Ga0466715_002869 | 3300042616 | Bacteria | 5169 |
| 102 | Ga0160467_100357 | 3300012829 | Bacteria | 47687 |
| 103 | Ga0415639_067547 | 3300038395 | Bacteria | 5109 |
| 104 | Ga0466690_066625 | 3300042590 | Unclassified | 2828 |
| 105 | Ga0466696_439115 | 3300042596 | Unclassified | 3309 |
| 106 | JGI24702J35022_10077960 | 3300002462 | Bacteria | 1793 |
| 107 | Ga0466705_168803 | 3300042612 | Bacteria | 9701 |
| 108 | Ga0466735_162326 | 3300042624 | Bacteria | 4295 |
| 109 | Ga0466704_402739 | 3300042643 | Bacteria | 55146 |
| 110 | Ga0466704_439812 | 3300042643 | Unclassified | 3622 |
| 111 | Ga0466709_063703 | 3300042648 | Bacteria | 17406 |
| 112 | Ga0466724_38900 | 3300042649 | Unclassified | 1222 |
| 113 | Ga0466719_115314 | 3300042606 | Bacteria | 11709 |
| 114 | Ga0123355_10256087 | 3300009826 | Bacteria | 2456 |
| 115 | Ga0123355_10366368 | 3300009826 | Bacteria | 1893 |
| 116 | Ga0123355_10442758 | 3300009826 | Unclassified | 1643 |
| 117 | Ga0123356_10005130 | 3300010049 | Unclassified | 13416 |
| 118 | Ga0123356_10085626 | 3300010049 | Bacteria | 2990 |
| 119 | Ga0123356_10119177 | 3300010049 | Bacteria | 2563 |
| 120 | Ga0123356_10214098 | 3300010049 | Bacteria | 1978 |
| 121 | Ga0123353_10114632 | 3300010167 | Bacteria | 4339 |
| 122 | Ga0123353_10515746 | 3300010167 | Bacteria | 1736 |
| 123 | Ga0123354_10027638 | 3300010882 | Unclassified | 8937 |
| 124 | Ga0466711_374989 | 3300042615 | Bacteria | 87344 |
| 125 | Ga0466718_058234 | 3300042617 | Unclassified | 5172 |
| 126 | Ga0466726_295230 | 3300042619 | Bacteria | 1557 |
| 127 | Ga0466728_106760 | 3300042620 | Unclassified | 9702 |
| 128 | Ga0160467_100208 | 3300012829 | Bacteria | 76225 |
| 129 | Ga0415639_001920 | 3300038395 | Bacteria | 64812 |
| 130 | Ga0415639_021608 | 3300038395 | Bacteria | 16597 |
| 131 | Ga0466691_102779 | 3300042593 | Bacteria | 4092 |
| 132 | Ga0466696_011571 | 3300042596 | Unclassified | 6027 |
| 133 | Ga0466727_234759 | 3300042655 | Bacteria | 2317 |
| 134 | Ga0466720_103371 | 3300042607 | Unclassified | 3619 |
| 135 | Ga0466698_432028 | 3300042610 | Unclassified | 1479 |
| 136 | Ga0123357_10148974 | 3300009784 | Unclassified | 2847 |
| 137 | Ga0123355_10361031 | 3300009826 | Bacteria | 1913 |
| 138 | Ga0123355_10459108 | 3300009826 | Bacteria | 1600 |
| 139 | Ga0123355_10480335 | 3300009826 | Bacteria | 1547 |
| 140 | Ga0123353_10072047 | 3300010167 | Bacteria | 5553 |
| 141 | Ga0160464_100909 | 3300012805 | Bacteria | 14990 |
| 142 | Ga0415639_041531 | 3300038395 | Bacteria | 4491 |
| 143 | Ga0466696_018635 | 3300042596 | Bacteria | 8932 |
| 144 | Ga0466705_105108 | 3300042612 | Bacteria | 12492 |
| 145 | Ga0466705_248334 | 3300042612 | Bacteria | 3433 |
| 146 | Ga0466704_290248 | 3300042643 | Bacteria | 6888 |
| 147 | Ga0466704_519375 | 3300042643 | Bacteria | 1189 |
| 148 | Ga0466714_150553 | 3300042603 | Bacteria | 5852 |
| 149 | Ga0466722_008187 | 3300042609 | Bacteria | 3897 |
| 150 | Ga0466698_331128 | 3300042610 | Bacteria | 1459 |
| 151 | Ga0123353_10001034 | 3300010167 | Bacteria | 34091 |
| 152 | Ga0123353_10215682 | 3300010167 | Bacteria | 3006 |
| 153 | Ga0123353_10639550 | 3300010167 | Bacteria | 1509 |
| 154 | Ga0123354_10049445 | 3300010882 | Bacteria | 6377 |
| 155 | Ga0466715_177243 | 3300042616 | Bacteria | 3368 |
| 156 | Ga0466726_115866 | 3300042619 | Unclassified | 4170 |
| 157 | Ga0160470_100209 | 3300012813 | Unclassified | 48095 |
| 158 | Ga0160445_105903 | 3300012847 | Bacteria | 2045 |
| 159 | JGI24702J35022_10015125 | 3300002462 | Bacteria | 4251 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 105 | 314 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.