Protein Family IF13075

Metagenome Isolate
121 Members
52 Samples
102 Scaffolds
682.82 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940302308|2940302935|
Length
707 aa
Sequence
MLYLRMEKPVIDIDKRSITYLPGVGPKKAEVLKKEADISSFEDLLYYFPYRYVDRSRFYRVAEIHEGMPYIQLKGRILSFETLGEGRTRRLVARFTDGSGTIELVWFKGIAYVKDKYVIGKEYIVFGKPTAFGHTCNIAHPDIDSVDQAGQVSGGLTPYYNTTEKMKKSFLNSRTIQGLQYTLLSMLNWELPETLPADVLQKTKLVSRSEAIRNIHFPESAAALKQAQLRLKFEELFYIQLNILQTAAYRKLKLKGLVFSTVGEHFNTFYKDYLPFELTDAQKRVVREVRGDMGSGRQMNRLLQGDVGSGKTLVALLAMLLAIDNNYQACMMAPTEILANQHLVTVMEFLKDMNVRVALLTGSTKKKERDKILPAIAAGEIDIVIGTHALIEETVVFKSLGLAIVDEQHRFGVEQRAQLWKKNTTIPHVLVMTATPIPRTLAMTLYGDLDVSVIDQLPPGRKPVLTLHRYDNKKKELYEFLRKEIVLGRQVYVVYPLIEGSEKLDYKNLEEGFDVFKEVFPEYTVCMVHGRMKAAEKDAEMQKFISGEAQILMATTVIEVGVNVPNASVMVIESAERFGLSQLHQLRGRVGRGAEQSYCILVSSYKLSNETRKRLEIMVQTSNGFEIAEADLKMRGHGDLEGTRQSGIGIDLKIASLSSDGQILQYARDVAQDVLNLDPNLSECSHAILRKRLSVLFEKKTNWGMIS

📊 Sample Types

Isolate 15.7%
Metagenome 84.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 37.3%
Kalotermitidae 27.5%
Termitidae 11.8%
Unclassified 5.9%
Passalidae 5.9%
Termopsidae 5.9%
Rhinotermitidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2923982719 Parabacteroides sp. 52 Isolate Blattidae
7 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
8 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
9 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
17 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
18 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
19 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
32 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
33 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
34 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
37 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
38 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
45 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
46 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
47 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
48 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_036439 3300042659 Bacteria 2884
2 Ga0466733_180514 3300042659 Bacteria 51608
3 Ga0466690_195206 3300042590 Bacteria 8881
4 Ga0466690_402356 3300042590 Bacteria 64397
5 Ga0123353_10016860 3300010167 Bacteria 10700
6 Ga0466719_058000 3300042606 Bacteria 9226
7 Ga0466722_117304 3300042609 Bacteria 122884
8 Ga0466722_131065 3300042609 Bacteria 14179
9 Ga0466704_251609 3300042643 Bacteria 45182
10 Ga0466704_466683 3300042643 Bacteria 20367
11 Ga0466715_170709 3300042616 Bacteria 31822
12 Ga0466723_199549 3300042618 Bacteria 29083
13 Ga0466728_200547 3300042620 Bacteria 11228
14 Ga0466705_033838 3300042612 Bacteria 10009
15 2226980363 2225789003 Bacteria 39299
16 Ga0466706_105640 3300042599 Bacteria 39915
17 Ga0466713_098989 3300042602 Bacteria 18122
18 Ga0466716_236307 3300042605 Bacteria 13040
19 Ga0466716_374444 3300042605 Bacteria 10373
20 Ga0466716_429212 3300042605 Bacteria 5595
21 Ga0466735_026871 3300042624 Bacteria 47904
22 Ga0466703_197495 3300042636 Bacteria 27336
23 Ga0466704_108124 3300042643 Bacteria 8750
24 Ga0466704_131513 3300042643 Bacteria 17215
25 Ga0466704_152291 3300042643 Bacteria 6219
26 Ga0466704_236764 3300042643 Bacteria 4009
27 Ga0466709_083357 3300042648 Bacteria 39489
28 Ga0466708_377243 3300042652 Bacteria 7944
29 Ga0466711_346410 3300042615 Bacteria 12906
30 Ga0466715_432426 3300042616 Bacteria 8169
31 Ga0466723_298572 3300042618 Bacteria 9528
32 Ga0466728_282666 3300042620 Bacteria 52404
33 Ga0466690_038157 3300042590 Bacteria 30366
34 Ga0466691_060982 3300042593 Bacteria 10960
35 IMNBL1DRAFT_c0003075 3300000062 Bacteria 11018
36 IMNBL1DRAFT_c0007071 3300000062 Bacteria 5975
37 Ga0466703_135301 3300042636 Bacteria 13728
38 Ga0466703_405482 3300042636 Bacteria 7929
39 Ga0466704_306332 3300042643 Bacteria 8556
40 Ga0466704_348459 3300042643 Bacteria 12550
41 Ga0466708_110381 3300042652 Unclassified 5212
42 Ga0466690_122659 3300042590 Bacteria 11163
43 JGI24702J35022_10026021 3300002462 Bacteria 3154
44 Ga0466706_094705 3300042599 Bacteria 26280
45 Ga0466713_070515 3300042602 Bacteria 21153
46 Ga0466716_306257 3300042605 Bacteria 14675
47 Ga0466703_348271 3300042636 Bacteria 2948
48 Ga0466704_437179 3300042643 Bacteria 6863
49 Ga0466708_047593 3300042652 Bacteria 5569
50 Ga0466711_074773 3300042615 Bacteria 6626
51 Ga0466715_056991 3300042616 Bacteria 24202
52 Ga0466715_162456 3300042616 Bacteria 4920
53 Ga0466715_215776 3300042616 Bacteria 39785
54 Ga0466726_274599 3300042619 Bacteria 2859
55 Ga0466728_030496 3300042620 Bacteria 10948
56 Ga0466705_287750 3300042612 Bacteria 7024
57 Ga0466705_347674 3300042612 Bacteria 29568
58 Ga0265387_1001066 3300024582 Bacteria 4081
59 Ga0466691_070237 3300042593 Bacteria 13056
60 Ga0466696_001911 3300042596 Bacteria 82336
61 2227494083 2225789004 Bacteria 20109
62 IMNBL1DRAFT_c0000206 3300000062 Bacteria 51916
63 Ga0123356_10034749 3300010049 Bacteria 4711
64 Ga0466713_002896 3300042602 Bacteria 13006
65 Ga0466713_029067 3300042602 Bacteria 9786
66 Ga0466709_275063 3300042648 Bacteria 136526
67 Ga0466711_029243 3300042615 Bacteria 21118
68 Ga0466711_268980 3300042615 Bacteria 10316
69 Ga0466711_467682 3300042615 Bacteria 24337
70 Ga0466715_100800 3300042616 Bacteria 5189
71 Ga0466715_529663 3300042616 Bacteria 3186
72 Ga0466690_237804 3300042590 Bacteria 15962
73 Ga0466696_222239 3300042596 Bacteria 6041
74 Ga0466719_017423 3300042606 Bacteria 18388
75 Ga0466719_566263 3300042606 Bacteria 3412
76 Ga0466703_143736 3300042636 Bacteria 14178
77 Ga0466709_341052 3300042648 Bacteria 7543
78 Ga0466708_253997 3300042652 Bacteria 12551
79 Ga0466727_328786 3300042655 Bacteria 4323
80 Ga0466711_262846 3300042615 Bacteria 4229
81 Ga0466733_000712 3300042659 Bacteria 18066
82 Ga0466657_017251 3300042582 Bacteria 33226
83 Ga0466692_095605 3300042591 Bacteria 21856
84 Ga0466696_345491 3300042596 Bacteria 31360
85 Ga0466696_364335 3300042596 Bacteria 6381
86 IMNBL1DRAFT_c0000425 3300000062 Bacteria 35440
87 JGI24702J35022_10003876 3300002462 Bacteria 8973
88 JGI24702J35022_10008441 3300002462 Bacteria 5828
89 Ga0466716_438073 3300042605 Bacteria 28886
90 Ga0466722_013414 3300042609 Bacteria 34349
91 Ga0466708_314705 3300042652 Bacteria 32048
92 Ga0466711_366859 3300042615 Bacteria 14957
93 Ga0466715_016154 3300042616 Bacteria 10007
94 Ga0466732_394096 3300042656 Bacteria 12185
95 Ga0466696_010344 3300042596 Bacteria 7486
96 2227619058 2225789004 Bacteria 45134
97 Ga0068305_10048715 3300005083 Bacteria 4192
98 Ga0466707_048902 3300042601 Bacteria 3199
99 Ga0466707_377418 3300042601 Bacteria 7096
100 Ga0466722_058847 3300042609 Bacteria 5707
101 Ga0466727_032457 3300042655 Bacteria 13166
102 Ga0466715_050477 3300042616 Bacteria 53095

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19833 RecG_dom3_C ATP-dependent DNA helicase RecG, domain 3, C-terminal 621 707 0.99
PF17191 RecG_wedge RecG wedge domain 18 169 0.9
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 72 143 0.89
PF00176 SNF2-rel_dom SNF2-related domain 298 441 0.84
PF00271 Helicase_C Helicase conserved C-terminal domain 476 592 0.83
PF00270 DEAD DEAD/DEAH box helicase 280 442 0.83
PF04851 ResIII Type III restriction enzyme, res subunit 276 436 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01336 GO:0003676 nucleic acid binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.