Protein Family IF13060
Metagenome
Isolate
157
Members
73
Samples
123
Scaffolds
265.92
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2940202316|2940202322|
- Length
- 306 aa
- Sequence
- MILIAVISLGSIGAVGALLLYAASKKFEVYEDPRIAQVQDALPAANCGGCGFPGCAGFASACVKADSLDHLYCPVGGTEVMSKVAAILGKEAGTADPMVAVVRCNGTCAARPKTNQYDGAQTCAIASALYGGETGCTYGCLGFGDCVTVCDFDAIHINPETGLPEVIEDKCTSCGACVKACPKSIIELRKKGPKSRRVFVSCINKDKGALARKACANACIGCGKCVKECPFEAITLENNLAYIDYDKCRVCRKCVPVCPTGAIWEVNFPPRKEKEAVQSNPEEGKTPSSEQTPGTDGTTEKIIQHK
Sample Types
Isolate
21.7%
Metagenome
78.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
36.1%
Kalotermitidae
19.4%
Termitidae
18.1%
Unclassified
13.9%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Passalidae
2.8%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 11 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 12 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 13 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 14 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 15 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 16 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 17 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 22 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 23 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 24 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 32 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 33 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 34 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 35 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 36 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 37 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 38 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 39 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 43 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 44 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 45 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 46 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 56 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 57 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 63 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 64 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 65 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 66 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 67 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 68 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 69 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 70 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 71 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 72 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 73 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_242421 | 3300042612 | Bacteria | 31459 |
| 2 | Ga0466690_143976 | 3300042590 | Bacteria | 7899 |
| 3 | Ga0466706_188691 | 3300042599 | Bacteria | 5667 |
| 4 | Ga0466714_027149 | 3300042603 | Bacteria | 1168 |
| 5 | Ga0466719_258826 | 3300042606 | Bacteria | 13818 |
| 6 | Ga0466703_057153 | 3300042636 | Bacteria | 14977 |
| 7 | Ga0466709_151074 | 3300042648 | Bacteria | 5433 |
| 8 | Ga0466708_232699 | 3300042652 | Bacteria | 12793 |
| 9 | Ga0466710_033475 | 3300042613 | Bacteria | 1649 |
| 10 | Ga0466715_289503 | 3300042616 | Bacteria | 56247 |
| 11 | Ga0466705_151337 | 3300042612 | Bacteria | 6479 |
| 12 | Ga0466656_313567 | 3300042550 | Bacteria | 5028 |
| 13 | Ga0466690_325101 | 3300042590 | Bacteria | 7661 |
| 14 | Ga0466706_039016 | 3300042599 | Bacteria | 1977 |
| 15 | Ga0466706_051177 | 3300042599 | Bacteria | 66113 |
| 16 | Ga0466716_283586 | 3300042605 | Bacteria | 36250 |
| 17 | Ga0466735_002456 | 3300042624 | Bacteria | 12388 |
| 18 | Ga0466703_029735 | 3300042636 | Bacteria | 12751 |
| 19 | Ga0466703_291043 | 3300042636 | Bacteria | 27662 |
| 20 | Ga0466708_034052 | 3300042652 | Bacteria | 11502 |
| 21 | Ga0466708_235488 | 3300042652 | Bacteria | 24641 |
| 22 | Ga0466727_055911 | 3300042655 | Bacteria | 9680 |
| 23 | Ga0466727_169926 | 3300042655 | Bacteria | 8533 |
| 24 | Ga0466715_589396 | 3300042616 | Bacteria | 12774 |
| 25 | 2227493803 | 2225789004 | Bacteria | 4002 |
| 26 | Ga0068305_10058765 | 3300005083 | Bacteria | 7893 |
| 27 | Ga0466697_106599 | 3300042611 | Bacteria | 91903 |
| 28 | Ga0466705_202926 | 3300042612 | Bacteria | 22976 |
| 29 | Ga0466705_331369 | 3300042612 | Bacteria | 5598 |
| 30 | Ga0466732_261268 | 3300042656 | Bacteria | 5072 |
| 31 | Ga0466691_002166 | 3300042593 | Bacteria | 21986 |
| 32 | Ga0466691_163416 | 3300042593 | Bacteria | 43349 |
| 33 | Ga0466696_095712 | 3300042596 | Bacteria | 8472 |
| 34 | Ga0466706_060125 | 3300042599 | Bacteria | 2970 |
| 35 | Ga0466706_138668 | 3300042599 | Bacteria | 11264 |
| 36 | Ga0466713_110171 | 3300042602 | Bacteria | 1475 |
| 37 | Ga0466719_325683 | 3300042606 | Bacteria | 5356 |
| 38 | Ga0466703_318215 | 3300042636 | Bacteria | 7867 |
| 39 | Ga0466704_014546 | 3300042643 | Bacteria | 4885 |
| 40 | Ga0466704_229792 | 3300042643 | Bacteria | 44121 |
| 41 | Ga0466709_015779 | 3300042648 | Bacteria | 19140 |
| 42 | Ga0466710_121363 | 3300042613 | Bacteria | 20587 |
| 43 | Ga0466715_045980 | 3300042616 | Bacteria | 33517 |
| 44 | Ga0466715_397213 | 3300042616 | Bacteria | 16485 |
| 45 | Ga0072941_1308119 | 3300005201 | Bacteria | 4615 |
| 46 | Ga0123355_10000037 | 3300009826 | Bacteria | 130470 |
| 47 | Ga0466733_108832 | 3300042659 | Bacteria | 18233 |
| 48 | Ga0466696_178044 | 3300042596 | Bacteria | 3034 |
| 49 | Ga0466706_068976 | 3300042599 | Bacteria | 62328 |
| 50 | Ga0466706_082746 | 3300042599 | Unclassified | 8043 |
| 51 | Ga0466706_129682 | 3300042599 | Bacteria | 50477 |
| 52 | Ga0466707_332168 | 3300042601 | Bacteria | 1257 |
| 53 | Ga0466703_400304 | 3300042636 | Bacteria | 16695 |
| 54 | Ga0466704_252197 | 3300042643 | Bacteria | 2807 |
| 55 | Ga0466704_579039 | 3300042643 | Bacteria | 1353 |
| 56 | Ga0466725_054758 | 3300042654 | Bacteria | 4059 |
| 57 | Ga0466711_267972 | 3300042615 | Bacteria | 4333 |
| 58 | Ga0466715_113935 | 3300042616 | Bacteria | 7771 |
| 59 | Ga0466723_231722 | 3300042618 | Bacteria | 6415 |
| 60 | Ga0466729_083010 | 3300042621 | Bacteria | 16334 |
| 61 | 2227554893 | 2225789004 | Bacteria | 2802 |
| 62 | Ga0123355_10000066 | 3300009826 | Bacteria | 112451 |
| 63 | Ga0123356_10115137 | 3300010049 | Bacteria | 2605 |
| 64 | Ga0466690_014363 | 3300042590 | Bacteria | 61479 |
| 65 | Ga0466693_192059 | 3300042592 | Bacteria | 1561 |
| 66 | Ga0466696_485112 | 3300042596 | Bacteria | 7496 |
| 67 | Ga0466707_198130 | 3300042601 | Bacteria | 6400 |
| 68 | Ga0466713_106369 | 3300042602 | Bacteria | 1542 |
| 69 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 70 | Ga0466714_041294 | 3300042603 | Bacteria | 4234 |
| 71 | Ga0466719_130583 | 3300042606 | Bacteria | 12871 |
| 72 | Ga0466735_183523 | 3300042624 | Unclassified | 1349 |
| 73 | Ga0466704_206738 | 3300042643 | Bacteria | 7961 |
| 74 | Ga0466725_259465 | 3300042654 | Bacteria | 1728 |
| 75 | Ga0466727_196236 | 3300042655 | Bacteria | 1390 |
| 76 | Ga0466728_461003 | 3300042620 | Bacteria | 2356 |
| 77 | 2226980369 | 2225789003 | Bacteria | 34607 |
| 78 | JGI24702J35022_10107509 | 3300002462 | Bacteria | 1532 |
| 79 | JGI24699J35502_11133978 | 3300002509 | Bacteria | 22406 |
| 80 | Ga0466705_329189 | 3300042612 | Bacteria | 2553 |
| 81 | Ga0466733_012710 | 3300042659 | Bacteria | 11988 |
| 82 | Ga0466690_031196 | 3300042590 | Bacteria | 10289 |
| 83 | Ga0466696_124388 | 3300042596 | Bacteria | 36262 |
| 84 | Ga0466696_325262 | 3300042596 | Bacteria | 5974 |
| 85 | Ga0466706_138140 | 3300042599 | Bacteria | 6931 |
| 86 | Ga0466713_050988 | 3300042602 | Bacteria | 3335 |
| 87 | Ga0466719_150749 | 3300042606 | Bacteria | 8865 |
| 88 | Ga0466722_209353 | 3300042609 | Bacteria | 1982 |
| 89 | Ga0466722_219747 | 3300042609 | Bacteria | 3741 |
| 90 | Ga0466704_063265 | 3300042643 | Bacteria | 9008 |
| 91 | Ga0466724_59296 | 3300042649 | Bacteria | 1922 |
| 92 | Ga0466727_126471 | 3300042655 | Bacteria | 9058 |
| 93 | Ga0466727_303169 | 3300042655 | Bacteria | 3509 |
| 94 | Ga0466711_289496 | 3300042615 | Unclassified | 6579 |
| 95 | Ga0466726_096678 | 3300042619 | Bacteria | 11771 |
| 96 | Ga0466728_380574 | 3300042620 | Bacteria | 13542 |
| 97 | Ga0466728_402448 | 3300042620 | Bacteria | 13423 |
| 98 | 2227619054 | 2225789004 | Bacteria | 45751 |
| 99 | Ga0466697_127599 | 3300042611 | Bacteria | 18079 |
| 100 | Ga0466691_048035 | 3300042593 | Bacteria | 1517 |
| 101 | Ga0466696_317252 | 3300042596 | Bacteria | 26380 |
| 102 | Ga0466696_432652 | 3300042596 | Bacteria | 1230 |
| 103 | Ga0466707_130825 | 3300042601 | Bacteria | 5810 |
| 104 | Ga0466716_109500 | 3300042605 | Bacteria | 25649 |
| 105 | Ga0466719_152967 | 3300042606 | Bacteria | 2512 |
| 106 | Ga0466735_083079 | 3300042624 | Bacteria | 2149 |
| 107 | Ga0466704_009251 | 3300042643 | Unclassified | 4851 |
| 108 | Ga0466704_266903 | 3300042643 | Bacteria | 41558 |
| 109 | Ga0466723_075931 | 3300042618 | Bacteria | 72847 |
| 110 | Ga0466728_057961 | 3300042620 | Bacteria | 56835 |
| 111 | 2227541031 | 2225789004 | Bacteria | 2988 |
| 112 | JGI24702J35022_10161066 | 3300002462 | Bacteria | 1264 |
| 113 | Ga0068305_10016637 | 3300005083 | Bacteria | 21059 |
| 114 | Ga0466696_049124 | 3300042596 | Bacteria | 3972 |
| 115 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 116 | Ga0466735_051013 | 3300042624 | Bacteria | 5895 |
| 117 | Ga0466735_225962 | 3300042624 | Bacteria | 2382 |
| 118 | Ga0466704_306015 | 3300042643 | Bacteria | 16226 |
| 119 | Ga0466709_003381 | 3300042648 | Bacteria | 24947 |
| 120 | Ga0466727_173972 | 3300042655 | Bacteria | 11139 |
| 121 | Ga0466711_034823 | 3300042615 | Bacteria | 24346 |
| 122 | Ga0466723_216363 | 3300042618 | Bacteria | 9719 |
| 123 | Ga0466728_004763 | 3300042620 | Bacteria | 36943 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13237 | Fer4_10 | 4Fe-4S dicluster domain | 217 | 259 | 0.96 |
| PF00037 | Fer4 | 4Fe-4S binding domain | 242 | 263 | 0.95 |
| PF12837 | Fer4_6 | 4Fe-4S binding domain | 241 | 263 | 0.95 |
| PF12838 | Fer4_7 | 4Fe-4S dicluster domain | 219 | 262 | 0.95 |
| PF13187 | Fer4_9 | 4Fe-4S dicluster domain | 218 | 263 | 0.95 |
| PF04060 | FeS | Putative Fe-S cluster | 42 | 64 | 0.93 |
| PF12797 | Fer4_2 | 4Fe-4S binding domain | 164 | 182 | 0.91 |
| PF14697 | Fer4_21 | 4Fe-4S dicluster domain | 217 | 263 | 0.9 |
| PF13484 | Fer4_16 | 4Fe-4S double cluster binding domain | 170 | 231 | 0.82 |
| PF13534 | Fer4_17 | 4Fe-4S dicluster domain | 170 | 230 | 0.79 |
| PF13183 | Fer4_8 | 4Fe-4S dicluster domain | 169 | 231 | 0.71 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04060 | GO:0051536 | iron-sulfur cluster binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.